KEGG   Pedobacter cryoconitis: AY601_1910Help
Entry
AY601_1910        CDS       T04341                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00500  Starch and sucrose metabolism
pcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AY601_1910
Enzymes [BR:pcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AY601_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1939 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: AMP98817
UniProt: A0A127VC76
LinkDB All DBs
Position
2204483..2205886
Genome map
AA seq 467 aa AA seqDB search
MNKESSYLPGRTALIMAFFLSFSACKKSAITDLAPADNFKQTQVDAATGSGSDVMMQAFY
WDVPQGGWWNTLNDKIPAWKAAGIGAIWLPPATKAQGGATSMGYDPYDYFDFGSYNQMGT
KPTRFGDSTSLGKLIATAHNNSIKVYADIVLNHCSGGTLEANPYTSTSTYTKFTPLSGKF
QRTYNDFHPNDIEAADEGAFAGFPDLCHKKANVSNWIYNASYSMSKFYKNSLHFDGFRFD
YVKGYGAWVVKNFVNSVGGPAAVFAVGEEWDGNAANLQNWVDATEQTSSAFDFACFYAMN
SAFDKNDLTRLNDDMLLKRNAAKAVTFVSNHDTDITTNKYSAYAYIMTHEGYPCVFYKDY
ENLLDKNRMNNLIWIHKNLAGGTTTNLYSAADQYIDRRNGYGTLPGLIVYFNGSDNWQQQ
WVTSNWGGKKIKEYTGASNWEPTVAADGRVLIQVPPHAYSIWSVTGL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagaatcatcttacctaccaggaaggactgcccttattatggccttttttctc
tccttttctgcctgcaaaaagtcagcaatcactgaccttgccccagcagataattttaaa
cagactcaagtagatgctgctaccggttcgggaagcgatgtcatgatgcaagcattttac
tgggacgttcctcagggcggctggtggaatacactgaatgacaaaatcccagcatggaaa
gcagcaggaattggtgcaatatggcttccacccgctactaaagcacaaggtggtgcaaca
agcatgggttatgatccatacgattattttgatttcggcagctacaatcaaatgggaaca
aaacccacacgatttggagattccaccagccttggcaaattgatagctactgcgcacaat
aatagtataaaagtatatgctgatatcgtgctcaatcattgcagcggaggaaccttagaa
gcgaacccttataccagtaccagtacttatactaaatttactccgctatccggtaaattc
cagcgtacctacaatgatttccatccaaacgacatagaagccgctgatgagggtgctttt
gccggattcccggatctttgccataaaaaagcaaatgtctctaactggatttataacgca
tcttatagcatgtctaaattctataaaaacagtctccactttgatggatttcgttttgat
tatgtaaaaggttatggggcctgggtagtcaaaaacttcgtgaacagcgtaggtggccct
gcagctgtttttgctgtcggtgaggaatgggatggaaatgcagcaaatttacagaactgg
gtagatgcaactgaacaaacctcttcagcttttgattttgcctgtttttatgccatgaac
agtgcttttgataagaatgacctgacgcgtcttaacgatgatatgttattaaagagaaac
gcagccaaggctgttacttttgtgagtaaccacgatacagatattacgacgaataaatat
tctgcttacgcttatatcatgacacatgaaggctatccttgtgtcttttataaagattac
gagaatctgctggacaaaaacaggatgaataacctgatctggatccataaaaatctggct
ggagggacaacgaccaatttatattcagccgctgatcagtatattgacagaagaaatgga
tacggtacgcttcctggattaattgtctactttaatggttctgataactggcaacaacag
tgggtaacttctaactggggtggtaaaaagataaaagaatatacaggcgcatctaactgg
gagccaactgttgcagctgacggaagggtattgatacaagttcctccacatgcctattca
atctggtctgttaccggattataa

DBGET integrated database retrieval system