KEGG   Pedobacter cryoconitis: AY601_2761Help
Entry
AY601_2761        CDS       T04341                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00500  Starch and sucrose metabolism
pcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AY601_2761
Enzymes [BR:pcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AY601_2761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C Big_5
Motif
Other DBs
NCBI-ProteinID: AMP99644
UniProt: A0A127VEA1
LinkDB All DBs
Position
complement(3257635..3259776)
Genome map
AA seq 713 aa AA seqDB search
MKKLILIACLCGCLTIAKAQQLKSPDGKLTMTFALEDGGKPRYSLVYKNKDVIKPSKLGL
ELKDDKKSLLSDFTVTDTKTSSFDENWKPVWGEVKTIRNHYNELAVTLTQKETNRIMIIR
FRMFNEGLGFRYEFPAQKNLTYFIVKEEKTQFAMAGDHTAFWIAGDYDTQEYDYTTSKLS
EIRSLAAKNRKENLSQTSFSPTGVQTSLMMKTSNGLYINLHEAALINYACMHLNLDDKNM
IFESWLTPDVKGDKGYMQAPANSPWRTVMVSDDARDILASKMTYNLNDPGKIEDTSWIKP
IKYVGVWWEMITGKSTWAYTDEYPSVQLGITDYSKARPNGKHGANTTNVKKYIDFAAKNG
FGGVLVEGWNEGWEDWYGHSKDYVFDFVTPYPDFNVSEIRDYAKSKGIKMIMHHETSGSV
RNYERHIDTAYKFMKANGYDAVKSGYVGNILPRGENHYSQWLINHYQYALEKAAEYKIMV
NAHEAVRPTGIARTYPNLIGNESARGTEYQAFGGSKPNHVTVLPFTRLIGGPMDYTPGIF
EMDISKLNPANHSHVNSTIANQLALYLTMYSPLQMAADLPENYERFPDAFQFIKDVAVDW
DDSQYLEAEPGQYITVARMAKGTGQWFAGSVNGDNSRISNISFSFLAPGRTYEATIYADA
KDAHYKTNPQAYTVRKVLVTNKSKLAQLCAPGGGYAISFKIANQATVKGLKKL
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctaattttaatagcgtgtttatgtggctgcttaactattgccaaagcccag
caactcaaatctccggatggaaaactgaccatgacttttgcattggaagacggtggtaaa
ccgcgttacagcctggtctataaaaataaagatgtaattaagccaagtaagctcggactg
gagcttaaagatgataaaaaatctttactatcagactttactgtaactgatactaaaact
tcctcttttgatgaaaattggaaaccagtttggggtgaggtaaaaactatccgtaaccac
tataatgaattagctgttaccttgactcagaaagaaacaaacaggataatgattatccgt
ttcagaatgtttaacgaaggtttaggatttcgttacgaattcccggcacagaaaaatctg
acatattttatagtcaaagaagaaaaaacacaatttgcaatggcaggagatcatactgca
ttctggatagctggagattatgatacgcaagaatatgattatacgacttcaaaactttct
gaaataagaagcctggctgcaaaaaacagaaaagaaaatctttctcagacttccttttct
ccaactggtgtgcagacttctttaatgatgaaaaccagtaatggattatatataaatttg
catgaagctgcgctgattaattatgcttgtatgcacctgaatctggatgataaaaacatg
atttttgaatcatggcttacaccagacgtaaaaggagataagggatatatgcaggcgcca
gctaattcgccatggcgtaccgttatggtcagtgatgatgctcgtgatattctggcttca
aaaatgacgtataacctgaatgatccgggtaagatagaggatacgtcatggattaaacca
atcaaatacgttggtgtatggtgggaaatgattaccggaaagtctacctgggcttatacc
gatgagtacccgtcagtacagctaggtattactgattattcaaaagccagaccaaatggc
aaacatggtgcaaacactactaatgtcaaaaaatatattgattttgctgctaaaaatggt
tttggtggtgtcctggttgaaggctggaatgaaggctgggaagactggtatggccactca
aaggattatgtatttgactttgttaccccttatccagattttaatgtgtctgaaatcaga
gactacgccaagtctaaaggtataaaaatgattatgcatcatgaaacctcaggttcagta
cgtaactatgaacgtcatattgatacagcttataaatttatgaaagctaatggttatgat
gcagttaaaagcggttatgtaggcaatattctgccaagaggcgaaaatcattatagccag
tggctaataaaccattatcagtatgcattggaaaaagctgcagaatataagataatggtc
aatgcgcacgaagcagtccgcccaacaggtattgcacgtacttatcctaacctgattggt
aatgagtctgcaagaggtacagaatatcaagcttttggtggatctaaaccaaatcatgtt
actgtacttccatttacacgtttgatcggtggaccaatggattatacacctggaattttt
gaaatggatatcagcaagctcaacccagctaatcattctcatgtaaatagtacgattgct
aatcagcttgcactttatttaaccatgtacagtccgttgcagatggcagccgatttacct
gagaattatgaaagatttcctgacgcttttcaatttattaaagacgtagcagtggattgg
gatgatagtcaatatctggaagcagaacctggccagtatataactgttgcgcgtatggca
aaggggaccggacagtggtttgcaggaagtgtaaatggtgataattcacgtatatccaac
atctctttcagcttcctggcacctggtagaacttatgaggctactatttatgctgatgca
aaggatgcacattataaaactaatccccaggcttatactgtccgtaaggtattggtaact
aataaatcaaaactagctcagctttgtgctccgggtggtggttatgcgatcagctttaaa
atagctaaccaggcaactgttaaaggattgaaaaaactatag

DBGET integrated database retrieval system