KEGG   Pedobacter cryoconitis: AY601_3229Help
Entry
AY601_3229        CDS       T04341                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00564  Glycerophospholipid metabolism
pcm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AY601_3229
Enzymes [BR:pcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AY601_3229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Pyr_redox_2 Thi4 FAD_binding_3 NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMQ00100
UniProt: A0A127VFN6
LinkDB All DBs
Position
complement(3843694..3845301)
Genome map
AA seq 535 aa AA seqDB search
MIRRPLHMNTSRKELIGNIVDPEKVWDVIVVGGGATGLGAALDAASRGYQTLLLEQADFA
KGTSSRSTKLVHGGVRYLAQGDIGLVREALYERGLLLKNAAHLVKNESFIIPNYEWWGGA
FYTIGLTLYDLLAGKLGFGRARHISKKEVISKLATIQPDHLYGGVVYHDGQFDDSRLAVN
LAQTSLEQGATILNYIRVTSLIKDAQDKVAGVVATDIESDITYQLKGKTVINATGVFVDD
LLQMDKPGKKPLVRSSQGVHLVIERSFMPGEDAIMIPKTDDGRVLFVVPWHDKLVVGTTD
TPLDQHSLEPVALEEEIEFIMRTAAKYLVKAPTRKDVLSVFAGLRPLAAPEDGSSKTKEI
SRSHKLIVTTSGLITITGGKWTTYRRMGEDTINKAIEVGKLPARPTKTKELSIHGSKANV
NRNDHLYVYGSDEAGVLALGDENPAWKEKLHARLPYLQAEVIWGVRYEMARTVEDILARR
VRALFLDARAAIDMAPAVAKLVATELQYDEAWENEQVKTFRKLAQSYLLEPYTPE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgataaggaggccattacacatgaatacaagtagaaaagaactcataggaaatattgtt
gatccggaaaaggtttgggatgtcattgtagttggtggtggtgcaacaggtttaggtgct
gcgcttgatgcagccagccggggttaccagaccttattgttagaacaggctgattttgca
aaagggacatccagccggagtactaaattagtccatggaggtgtgcgttatttagcgcaa
ggcgatatcggactggttagagaggcgttatatgagcgtggtttgcttttgaaaaatgca
gctcacttagtgaaaaatgaatctttcattattccgaattatgaatggtggggtggtgct
ttttatacgataggattaacattatatgatttgcttgctggtaaactgggcttcggccgt
gccaggcatatttctaagaaagaggtaatcagcaaacttgctactatacagcctgaccat
ttatatggaggtgtagtttaccatgacggacaatttgatgattcccgtcttgcggtgaat
cttgcacagaccagtctggaacaaggggctacgatcttaaattatatccgggtcacaagc
ttaattaaagatgcgcaggataaagtagctggtgtagtggcgactgatatagaatcggac
attacctatcagctgaaaggtaaaacggtgattaatgcgaccggagtatttgtagatgat
cttttacaaatggataaaccgggtaaaaagccattggtcagatcaagccagggtgtacat
ctggtcattgagcgttcatttatgcctggcgaggatgcgatcatgatccctaaaacggat
gacggcagggttttattcgtggtgccatggcatgataaattagtagtaggaactacagac
acgccattagaccagcatagcctggagccggtagcgttagaagaggagatcgaatttatt
atgcgtacagcggcaaaatatctggttaaagcgcctacgcgtaaagatgtgctgagtgta
tttgcaggtttacgtcctttagcagccccagaagatggttcctctaaaacaaaagaaatt
tcaagaagtcataaactgatcgtcactacatcgggactgattacaattaccggtgggaag
tggacaacttaccgcaggatgggggaggacaccattaataaagcaatagaagttggtaaa
ttaccagcccgtcctacaaaaacaaaagagctttctatccacggtagtaaagcaaatgta
aaccgcaatgatcacttatatgtttacggaagtgatgaggcaggggtattagctttaggc
gatgaaaacccagcctggaaagaaaagctgcatgcgcgtttaccttatcttcaagccgaa
gtaatctggggtgtccgatatgaaatggcccgtactgtagaggatattttagccagaagg
gtgagagcgttattcttggatgcacgtgctgcgattgatatggcccctgctgtagctaaa
ctggtagcgacagaacttcagtatgatgaagcctgggaaaatgagcaggtaaaaaccttc
agaaaactcgctcaatcttatttattagaaccttatacgcctgaatag

DBGET integrated database retrieval system