KEGG   Pedobacter cryoconitis: AY601_3945Help
Entry
AY601_3945        CDS       T04341                                 

Definition
(GenBank) Pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00010  Glycolysis / Gluconeogenesis
pcm00020  Citrate cycle (TCA cycle)
pcm00620  Pyruvate metabolism
pcm01100  Metabolic pathways
pcm01110  Biosynthesis of secondary metabolites
pcm01120  Microbial metabolism in diverse environments
pcm01130  Biosynthesis of antibiotics
pcm01200  Carbon metabolism
Module
pcm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AY601_3945
   00020 Citrate cycle (TCA cycle)
    AY601_3945
   00620 Pyruvate metabolism
    AY601_3945
Enzymes [BR:pcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AY601_3945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 PYNP_C DUF2118
Motif
Other DBs
NCBI-ProteinID: AMQ00801
UniProt: A0A127VHX8
LinkDB All DBs
Position
complement(4657349..4659010)
Genome map
AA seq 553 aa AA seqDB search
MAEVVKMPKMSDTMTEGVMAKWHKKVGDKVKSGDVLAEVETDKATMDLESYWDGTILFIG
VEEGKAVPVDAVIAVIGKEGEDYKAALDAEGAAAPAKGEKAAEEKPVEEAPKAETKGAAV
TDADLEKQGVTVVRMPLLSDTMTEGVIAEWHKKVGDKIKNDDILADVETDKATMEVMGYA
DGTLLHIGVEKGAAAKVNGIIAIVGPEGFDISGILNQGDAPAKPAADKPAADQADAPVKE
AAPAEAQEETHTADGSRLKASPLAKRIAKEKGIDLAQVAGSADGGRIIKKDIENFKPAAA
AAKGTEAASAPASAEKSAPVLAQYIGEEKYTEKPVSQMRKVIAKRLSESLFTAPHFYLTM
SIDMDAAMAARVKMNEFSPVKLSFNDLVIKAVAVALKQHPNVNSSWLGDKIRYNEHVNVG
VAIAVEDGLLVPVVRFADGKSLSRISAEVKDFAQRAKAKKLQPSDWEGSTFTVSNLGMFG
IDEFTAIINTPDSCILAVGGISQVPVVKNGAVVPGNVMKVTLSCDHRTVDGATGAAFLQT
FKALLEEPVRLLV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagttaagatgcccaaaatgagcgacaccatgaccgaaggggtaatggcg
aagtggcataaaaaagttggcgataaagttaaaagtggagatgttctggcagaagtagaa
accgataaggcgactatggatctggaatcctactgggatggcaccatcctttttattggt
gtagaagaaggtaaagctgttcctgttgatgctgtaattgcagttatcggtaaagaaggc
gaagattataaagctgctcttgacgcagaaggtgctgctgcaccggcaaaaggggaaaaa
gctgctgaagaaaaacctgttgaagaagctccgaaagctgaaacaaaaggtgctgcggta
actgatgctgatctggaaaaacaaggggttacggtagtccgtatgccattgttaagcgat
accatgactgaaggcgtaattgctgaatggcataaaaaagtaggtgataaaattaaaaat
gatgatatccttgctgatgtagaaaccgataaggcgactatggaagtaatgggttatgca
gatggaactttattacatattggtgtagaaaaaggagctgctgcaaaagtaaacggtatt
atcgcgatagtaggtccggaaggatttgatatcagcggaatattaaaccagggtgatgct
ccggcaaaacctgctgcagataaaccagctgctgatcaagcagatgctcctgttaaagaa
gctgctcctgcagaagcacaagaagaaacacatacagctgatggttcacgcctgaaagct
tctcctttagctaaaagaattgcaaaagaaaaaggtatagatcttgcacaggttgcaggt
agtgctgatggtggccgtatcattaagaaagatatcgaaaacttcaagcctgctgctgcg
gctgcaaaaggtacagaagctgcttcagctcctgcatctgctgagaaatcagcaccagtt
cttgcacaatatatcggcgaagaaaaatatacagagaaaccagtttctcaaatgcgtaaa
gtaatcgcgaaaagattatcagaaagcttattcactgcgccgcacttctatcttacgatg
agtattgatatggatgctgcaatggctgcacgtgtgaagatgaatgaattctctccggtt
aaactttcattcaatgatttagtgatcaaagcagtggctgttgccttaaaacaacatcca
aatgtgaactcttcatggttaggggataaaatccgttacaatgaacatgtgaacgttgga
gtagctattgccgttgaagacggattattagttcctgtggtacgttttgctgatggaaaa
tcattgtcacgtatctcagctgaggttaaagatttcgcacaacgtgcaaaagctaaaaaa
cttcagccttcagactgggaaggttcaactttcaccgtatctaacttaggtatgttcggt
attgatgaatttacagctattattaatacacctgattcttgtatccttgcagtaggcggg
atttcacaagtaccagtagttaaaaatggtgctgttgttcctggaaatgtaatgaaagtt
actttgagctgtgatcaccgtacggtagatggcgctacaggtgctgcattcttacaaaca
ttcaaagcattattagaagaaccagtaagattattagtttaa

DBGET integrated database retrieval system