KEGG   Pedobacter cryoconitis: AY601_4250Help
Entry
AY601_4250        CDS       T04341                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00620  Pyruvate metabolism
pcm00680  Methane metabolism
pcm01100  Metabolic pathways
pcm01120  Microbial metabolism in diverse environments
pcm01200  Carbon metabolism
Module
pcm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AY601_4250
  09102 Energy metabolism
   00680 Methane metabolism
    AY601_4250
Enzymes [BR:pcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AY601_4250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 GBP_repeat
Motif
Other DBs
NCBI-ProteinID: AMQ01099
UniProt: A0A127VJL2
LinkDB All DBs
Position
complement(4967351..4969939)
Genome map
AA seq 862 aa AA seqDB search
MTQKLRVTGPRESIFNNEVVSRFELYNSLFLTLPFYKIKDTGTLLPLFIKHCEDGVKNLK
TPAEIIKSFFERYTQTTDPKDIIDLLFRFIQYIERQVVLFDAVEDASFTKLNTTEDHSSL
RSMLKKSEFNAELHEKIAKLIEDFSLRLVLTAHPTQFYPGSVLSIINDLTTAIKINDIVT
INQLLQQLGKTPFFNKKSPTPVDEALSLTWYLENVFYFAAANIQSEIDSSLEEFNIPSKK
AIELGFWPGGDRDGNPNVHAQDTIQVSKMLRQILFRCYYRDFRKLKRRITFRGVEETVYK
VQDVLYKNAFDTNIEPANISEFLIENLNQIKDTLIEFHDGLFADLVDDLLRKVELFGSHF
ASLDIRQDSRVLRNVHAYCRQFKPIISLFPENFDELGEEEKIQLLSFKTAKVNYSGDADS
LTTDTLQTIAGIRQIQQQNGELACHRYIISNCQQASDILQLMELFLWNGWDEKELTIDFV
PLFETVSDLEGASQIMERLYTHPFYRKHLESRGNKQDIMLGFSDSTKDGGYLMANWSIFN
AKVALTATSVAHNIQLAFFDGRGGPPSRGGGKTHRFYASMGKEIANKNIQLTIQGQTISS
QYGSIDSAEFNIEQLINAGISSGLKEKHNILLDSPHKDILDVMAKDSFDAFVALRKHPLF
LNYLERFSPLSLLSKITISSRPVKRSSGEKLRLEDLRAISFVTAWGQLKQNIPGFYGIGT
ALKNQEASGNWDKIRKTYQESGYFKTIIDNGMMSMSKTDFSITAHFAKDPEFGDFWKMLR
DEYERSKEMLLKLAGHTTLMENYPVEKRSIAVREKIVLPLVLIQHFALENLQHQLDDEQL
QSYEKLAIRTVYGIVNAGRNSA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaaactaagagttacagggccaagagaatccatttttaacaacgaagttgtc
tccagattcgaactttacaacagcctgtttctaaccctcccattttataaaatcaaggat
actggcacattactgcccctttttattaaacactgtgaagatggtgtcaagaatctcaag
actcctgcagaaatcattaagagcttttttgagcgatatacccaaacaacagaccctaag
gatattatagatttactgttccgttttattcaatatatcgaacgtcaggttgtattattt
gatgctgttgaggatgcttcctttacaaaattaaatacaaccgaagaccacagttccctc
cggtctatgttgaaaaaaagtgaattcaacgcagagcttcatgaaaaaatagccaaactg
atcgaagatttctcgttgcgccttgtacttaccgcgcatccgacacaattctatcccggc
agtgtactttctattatcaacgacctgactacagcaattaagatcaatgacattgtcact
attaaccaattactgcagcaactaggtaaaactccgtttttcaacaagaaatctccaaca
ccggttgacgaagccttaagcttaacctggtatctggaaaacgttttttactttgccgca
gccaatatacagtcagaaatagacagtagcctggaggaatttaatatcccttcaaaaaaa
gcaatagaacttggtttctggccaggtggagaccgtgatggtaacccgaatgtgcacgca
caggataccatacaggtttcaaagatgctgcgtcagattttattccgctgttattacaga
gacttcagaaaactgaaacgaagaattactttcagaggagtggaagaaacagtttataaa
gtgcaggatgtgctttataaaaacgcttttgatacgaatattgagcctgcaaatatttca
gaattcctgattgaaaacctgaatcagattaaagatacgctgattgaattccatgacggt
ttatttgcggaccttgtagacgacctattgcgcaaagttgagcttttcggcagccatttt
gcctctctggacatcagacaggatagtagagtgcttcgtaatgttcatgcttattgcaga
caattcaaacctattatctcccttttccctgaaaacttcgatgaactgggagaagaagaa
aaaatacagttgctttctttcaaaactgcaaaagtaaattattccggtgatgccgattcg
ctgactactgataccttgcaaaccattgccgggatcagacagattcagcagcaaaatgga
gaacttgcctgtcaccgttatattatcagcaattgccagcaggccagcgatatccttcaa
ctcatggaattgtttctatggaacggttgggatgaaaaagaactgaccatagattttgta
ccgctgtttgaaacagtaagtgacctggaaggtgcttcacagattatggaacgcttatat
acacatccattttatagaaaacacctggaaagcagagggaacaaacaagatattatgctt
ggcttctcagacagcacaaaggatggtggttatctgatggctaactggtctatttttaat
gccaaggtagccctgactgcaacttcggtagcgcataacatacaattggcgtttttcgac
ggtcgtggtggccctccatcaagaggtggaggtaaaactcaccgcttttacgcttccatg
ggaaaagagattgccaataaaaatatacaattgactatccagggacaaacgatcagttca
caatacggttctattgatagtgcagagtttaatattgaacaattaatcaatgcagggatc
tcatccggcctgaaagaaaaacacaatattctactggattcaccacataaggatatttta
gatgtgatggcgaaggatagttttgatgcatttgtagctttacgtaaacatccattattt
ttaaattacctggagcgcttctctccgctgagtttattgtctaaaattacaatcagcagc
agaccagtcaaaagaagttcaggtgaaaaactgcgtttagaagaccttagggcaatcagt
tttgtaactgcctggggacaactgaaacagaatatcccagggttttatggaattggtact
gctttaaaaaatcaggaagcctcaggaaattgggataagatccgcaaaacctaccaggaa
tctggttattttaagacgattatagacaacggaatgatgtctatgagcaaaacagacttt
tccatcactgcacattttgccaaagatcctgaattcggtgatttctggaaaatgctccgt
gatgagtatgaacgctctaaagaaatgcttttaaaattagcagggcacactaccctgatg
gaaaactatccggtagagaaaagatcaatcgcagtcagagagaagattgttcttccttta
gtattgattcagcattttgctttagagaacttacagcatcagctggatgatgaacaactt
caatcttatgaaaaactggccatcagaaccgtttacggaattgtaaatgcaggtagaaac
tctgcctaa

DBGET integrated database retrieval system