KEGG   Cutibacterium acnes 6609: TIB1ST10_04555Help
Entry
TIB1ST10_04555    CDS       T02065                                 

Definition
(GenBank) L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
pcn  Cutibacterium acnes 6609
Pathway
pcn00040  Pentose and glucuronate interconversions
pcn00053  Ascorbate and aldarate metabolism
pcn01100  Metabolic pathways
pcn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TIB1ST10_04555
   00053 Ascorbate and aldarate metabolism
    TIB1ST10_04555
Enzymes [BR:pcn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     TIB1ST10_04555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEH29208
LinkDB All DBs
Position
958217..959104
Genome map
AA seq 295 aa AA seqDB search
MTESLTDGVTLGIYEKALVSNPLATDDDWRRFLNQVPEAGFSFVDLSVDESEERMARLGW
DQRRRRMVRHCVEATETAIGGVCLSVHRRIGPGSADPAVRQRAREVMGEGLQLCHDLGAP
VLQVAGYYCYYEQMNDHAEQWYTDLLLDAVPMAARLGVVMGIENVDGTDVTSIRKAMEFV
KLADSPYLQVYPDLGNIAEQQLDVVTELEAGRGHMVAIHVKDVRPGEPRRVPMGEGTVDW
DESFAVLAEQGWRGRMMIEMWNDDAPDSNTRSASARQFIEEHLRTAGIPVRRALF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatcactgaccgacggggtgaccctcggcatctatgagaaagccctcgtcagc
aaccccttggctaccgacgacgactggcgacgcttcctaaaccaggtacccgaggcagga
ttcagcttcgtcgacctgtccgtcgatgagtctgaagagaggatggcacggctcggatgg
gaccagcgccggcgtcgcatggtgcgccattgcgttgaggccacagaaaccgctattggt
ggtgtctgcttgtcggtacatcggcgtattggccctggtagtgccgacccagccgtgcgc
cagcgagctcgggaggtgatgggcgaaggattgcagctgtgccatgaccttggcgctcct
gtgcttcaggtcgcggggtattactgctactacgagcagatgaacgaccatgccgagcag
tggtacaccgacctcctgctcgatgccgtcccgatggctgcacggctgggggtcgtcatg
ggcatcgagaatgttgacggcaccgacgtcacctctatccggaaggcgatggagtttgtc
aagcttgccgactcgccctacctgcaggtgtacccagaccttggcaacattgccgagcaa
cagcttgacgtcgtgaccgaactcgaggccgggcggggccacatggtcgcgatccacgtc
aaggatgttaggccgggcgagcctcgtcgggtaccaatgggggagggcaccgtcgactgg
gacgagtccttcgctgtccttgctgagcagggttggcgcggccgaatgatgatcgagatg
tggaacgacgacgctcccgattccaacacgcgcagtgcgtcagcacgccagttcatagag
gagcatcttaggaccgctggaatcccggttcgccgcgccctcttttga

DBGET integrated database retrieval system