KEGG   Cutibacterium acnes 6609: TIB1ST10_04900Help
Entry
TIB1ST10_04900    CDS       T02065                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pcn  Cutibacterium acnes 6609
Pathway
pcn00020  Citrate cycle (TCA cycle)
pcn00190  Oxidative phosphorylation
pcn00650  Butanoate metabolism
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01120  Microbial metabolism in diverse environments
pcn01130  Biosynthesis of antibiotics
pcn01200  Carbon metabolism
Module
pcn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIB1ST10_04900 (sdhA)
   00650 Butanoate metabolism
    TIB1ST10_04900 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TIB1ST10_04900 (sdhA)
Enzymes [BR:pcn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TIB1ST10_04900 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     TIB1ST10_04900 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C NAD_binding_8 Pyr_redox GIDA Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AEH29277
LinkDB All DBs
Position
1031678..1033810
Genome map
AA seq 710 aa AA seqDB search
MNNWIEAVKKPLEMITGRHAGARPEEPGAELVKPEQLQPRRAESSSVARRAAKGPKARDI
LGPAQKKAGYLVGDELDGKAPEGDPLTAWTRRQSEYKLVNPANRRKMNVIVVGTGLSGSG
VAATLGQLGYHVDVFCFHDSPRRAHSVAAQGGINAARARKVDGDSLKRFVKDTVKGGDYR
GREADVVRLGTESVRVIDHMYAIGAPFAREYGGQLATRSFGGVQVSRTYYTRGETGQQLE
VACSQALQAQIDAGSVTMHNRTEMLDLIVADGTAQGIVTRDLLTGEIKAWTAHVVILCTG
GYGSVYHWSTLGKGSNATATWRAHRQGAYFASPCFVQFHPTALPVSSHWQSKTTLMSESL
RNDGRIWVPKKAGDDRPANDIPEEERDYYLERKYPAFGNLTPRDVASRNARTQIESGHGV
GPLKNSVYLDFRDAIERLGKKTIAERYGNLFDMYLDATGENPYEVPMRIAPGAHFTMGGL
WVDYDQMSTIPGLFVGGEASNNYHGANRLGANSLLSASVDGWFTLPLTVPNYLAGFVGKP
VLPLDAPEVSAAIERVQKRTDALLNCGGTHRPEWFHRKLGDILYEGCGVARDEAGLLDAL
TKVRELREEFWRDVKVVGTGNRLNQELEKAGRVADFIELGEVMILDALDRRESAGAHFRN
EYATEAGEAKRNDGDWCAVSAWETRPDGTKVRHSEPLSFSLIDLQVRDYR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaataactggattgaggccgtcaagaagcctctcgagatgattactgggcgtcatgcg
ggcgctagacccgaggagcctggcgctgaactagtgaaacccgagcagctccagcccaga
cgggctgagtcgtcgtcggtggcgagacgggctgccaagggtcccaaggctcgtgacatt
ctcggcccggcgcagaagaaggccggctaccttgttggtgacgaattggacggcaaggct
cccgagggggatccactcaccgcgtggacccgtcgtcaaagcgagtacaagctcgtcaat
ccggcgaaccgtcgcaagatgaacgtcatcgtggtgggaaccggcctctctggttccggg
gttgccgcaaccctcggccagctcggctaccacgtcgacgttttttgcttccacgattcc
ccgcgtcgagcccactcagttgctgcccagggaggtatcaacgctgcacgtgcccgcaag
gttgacggcgattcccttaagaggttcgtcaaggacaccgtcaagggtggtgactaccgg
ggccgagaggccgatgttgttcgactcggcaccgaatcggtacgggttattgaccatatg
tacgccatcggcgcgccgttcgcccgagaatatggcggtcagttggctactcgatctttc
ggaggcgtgcaggtttcgcgcacctactacacccgcggggagaccggtcagcagctcgaa
gtagcctgctcccaggccctccaggcacaaattgatgccggttcggtgacgatgcacaac
cgcaccgagatgcttgacctcatcgttgctgacggtacggctcagggcatcgtcacccgt
gaccttctcaccggcgagatcaaggcatggacggcccacgtcgtcatcctatgcaccggc
ggatatggatcggtgtaccactggtccaccttgggcaaagggtccaacgccaccgcgacg
tggcgtgctcaccgtcaaggtgcatacttcgccagcccctgcttcgtgcagttccacccg
accgcgctgcccgtcagttcgcactggcagtccaagaccacgctcatgagcgagtcgttg
cgcaacgacggccggatctgggtgcccaagaaagccggcgatgatcgtccagccaatgac
atcccggaagaggagcgcgactactatttggagcgcaagtacccggccttcggaaaccta
acgccgcgcgacgtcgcctcccgcaatgctcggactcagatcgagagcggccacggagtg
ggcccgcttaagaactcggtgtacctggatttccgtgatgccattgagcgtctaggaaag
aagacgattgccgagcgctatggcaacttgttcgacatgtatctcgacgccacgggggag
aatccctacgaggtgcccatgcgcatcgccccaggagcccattttacgatgggcggtctg
tgggttgactacgaccagatgagtaccatcccgggtctgttcgtcggtggtgaggcgtca
aacaactaccacggcgcgaaccgattgggggctaactccttgctgtcggccagtgtcgac
gggtggttcaccctgccactgacggtgccgaactatttggctgggttcgtcggaaagccc
gtgttacccctggacgcccccgaggtcagcgcagccattgagagggtgcagaagcgcact
gatgccttgctcaactgcggcggaacacaccgcccggaatggttccaccgcaagctcggc
gacatcctctatgaggggtgcggggtcgcccgcgacgaggccgggctgctcgacgccctt
acaaaggtgcgcgagctgcgtgaggagttctggcgcgacgtcaaggtggtcggaacggga
aaccgactcaaccaggaactcgagaaggccggtcgagtggccgacttcatcgagctcggc
gaggtcatgattcttgacgccctggaccgccgggaatcggcaggtgcacacttccgtaac
gagtacgccaccgaagccggtgaagccaaacgtaatgacggtgactggtgtgcggtttcg
gcatgggagacacgtcctgatggcaccaaggtgcggcatagcgaaccgttgtcgttctcg
ttgatcgatctgcaggtgagggattaccgatga

DBGET integrated database retrieval system