KEGG   Cutibacterium acnes 6609: TIB1ST10_04905Help
Entry
TIB1ST10_04905    CDS       T02065                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pcn  Cutibacterium acnes 6609
Pathway
pcn00020  Citrate cycle (TCA cycle)
pcn00190  Oxidative phosphorylation
pcn00650  Butanoate metabolism
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01120  Microbial metabolism in diverse environments
pcn01130  Biosynthesis of antibiotics
pcn01200  Carbon metabolism
Module
pcn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIB1ST10_04905
   00650 Butanoate metabolism
    TIB1ST10_04905
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TIB1ST10_04905
Enzymes [BR:pcn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TIB1ST10_04905
    1.3.5.4  fumarate reductase (quinol)
     TIB1ST10_04905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4 Fer4_4 Fer4_2 Fer4_6 Fer4_21 Fer4_18 Fer4_16 Fer4_22 Fer4_3 Fer4_15 Fer2
Motif
Other DBs
NCBI-ProteinID: AEH29278
LinkDB All DBs
Position
1033807..1034565
Genome map
AA seq 252 aa AA seqDB search
MRVELDIWRQNGPDAKGHFEHHVVEDAEPEWSLLELLDRLNDQIVENDGDPIVFESDCRE
GVCGCCGFMVNGKPHGPLPNTPACRQHLRAFPHITHFKIEPFRSAAFPVIRDLAIDRTSM
DHLIQAGGTVDVMTGTAPAADSVPQPHAEAEQALDFASCIGCGACVAACPNGAAMLFAGA
KLSHLAMMPQGRQERSKRARRMINALDEEFGPCSLYGECVEACPVSIPLVAVARVNRERW
RAGFRGAGSKDN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagggtggaactggatatctggcgtcagaacggccctgacgccaaaggacattttgag
caccacgttgtcgaagatgccgagccggagtggagcctgctggaattgctcgaccggctc
aacgatcagatcgtcgaaaatgacggtgatccgattgttttcgagtctgattgtcgtgag
ggagtgtgcgggtgctgtgggttcatggtcaacggcaagccccatggtccgctgccgaat
accccggcgtgtcgtcagcatttgagggcattcccccatatcacccatttcaaaattgag
ccattccgctcggcagcctttccggtcatccgtgacctagccatcgaccgtacgagcatg
gatcacctgatacaggccggtggaacggtcgacgttatgacgggcacggcccctgctgca
gattcggtgccgcagccgcatgccgaggccgagcaagctctcgacttcgcatcgtgtatt
ggatgcggagcgtgcgtggcggcttgtccaaatggcgcggcgatgcttttcgccggcgcg
aagctgtcgcacttggcgatgatgccgcaggggcgtcaggagcgttcgaagcgtgcgcga
cgcatgatcaacgcccttgatgaggagttcggtccgtgttccctgtatggcgagtgcgtt
gaggcctgcccggtgagcattccgttggtagccgtcgcccgggtcaaccgggagcgttgg
cgtgccggattccggggagcaggcagtaaggacaactga

DBGET integrated database retrieval system