KEGG   Cutibacterium acnes 6609: TIB1ST10_09320Help
Entry
TIB1ST10_09320    CDS       T02065                                 

Definition
(GenBank) superoxide dismutase (Mn/Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pcn  Cutibacterium acnes 6609
Brite
Enzymes [BR:pcn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TIB1ST10_09320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-ProteinID: AEH30136
LinkDB All DBs
Position
1983156..1983773
Genome map
AA seq 205 aa AA seqDB search
MAVYTLPDLDYDYGALEPHISGKIMELHHDKHHNTYVQGANTALEKLAEAREKGDFGTIN
KLEKDLAFNLGGHINHSVFWKNMSPHGGGRPEGNELAAAIDEFFGSFDSFKKQFEETAKG
VQGSGWGMLVWDVMGQRLNTMQLFDHQGNLPSTQIPVVQLDMWEHAYYLQYQNVKADYVT
AWWNVVSWTDAEQRFVKARSITGLF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttacacccttcccgatctcgactacgactacggagcactggagccccacatc
tcgggcaagatcatggaactgcaccatgacaagcaccacaacacctacgttcagggtgcc
aacaccgccctggagaagctggccgaggcccgcgagaagggcgacttcggaaccatcaac
aaactcgaaaaggacctggcctttaacctcggcggccacatcaaccactccgtgttctgg
aagaacatgtcccctcatgggggcggtcgtccggagggcaacgaactcgctgctgcgatt
gacgagttcttcggttcctttgacagcttcaaaaagcagtttgaggaaaccgctaagggc
gttcagggctccggctggggcatgctcgtgtgggacgtgatgggtcagcgcctcaacacc
atgcagctgtttgaccaccagggcaatctgccgtcaacccagatcccggtcgtccagctc
gacatgtgggaacacgcttattacctgcagtaccagaacgtcaaggccgactacgttacc
gcctggtggaacgtcgttagctggaccgacgccgagcagcggttcgtcaaggcccgttcg
atcaccggtttgttctga

DBGET integrated database retrieval system