KEGG   Cutibacterium acnes 6609: TIB1ST10_11545Help
Entry
TIB1ST10_11545    CDS       T02065                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pcn  Cutibacterium acnes 6609
Pathway
pcn00010  Glycolysis / Gluconeogenesis
pcn00030  Pentose phosphate pathway
pcn00051  Fructose and mannose metabolism
pcn00052  Galactose metabolism
pcn00680  Methane metabolism
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01120  Microbial metabolism in diverse environments
pcn01130  Biosynthesis of antibiotics
pcn01200  Carbon metabolism
pcn01230  Biosynthesis of amino acids
pcn03018  RNA degradation
Module
pcn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIB1ST10_11545
   00030 Pentose phosphate pathway
    TIB1ST10_11545
   00051 Fructose and mannose metabolism
    TIB1ST10_11545
   00052 Galactose metabolism
    TIB1ST10_11545
  09102 Energy metabolism
   00680 Methane metabolism
    TIB1ST10_11545
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    TIB1ST10_11545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcn01009]
    TIB1ST10_11545
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcn03019]
    TIB1ST10_11545
Enzymes [BR:pcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIB1ST10_11545
Protein phosphatases and associated proteins [BR:pcn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TIB1ST10_11545
Messenger RNA biogenesis [BR:pcn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TIB1ST10_11545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEH30576
LinkDB All DBs
Position
2453170..2455434
Genome map
AA seq 754 aa AA seqDB search
MHVDDEMRLTPTLPDGHGLRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVYAIYEGYQG
MIDGGDGIRRFGWDDVGSILNRGGTVIGTFRCKGMRERPGRLKAVRNLLEHGIDRLVVIG
GDGSLTGLDVLRTEWTDLVAELVDTGQVSAEVAREHPALMIAGLVGSIDNDLVGSDMTIG
ADTALHRIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMAAVAGGADYVLIPERPPED
GWEDRMCAELKRGRQAGRRDSIVVVAEGATDRSGNRISSEYVRQVLEDKLGEDARVTILG
HVQRGGRPSAYDRWASTWLGYHAVHEVLSTTPEAEGRVIGTGSNRIHRLPLVKAVADTKS
VPGLITEGRYNEAMRMRGRSFVEMDAIFTELSEPARTTSDTAGDADRKRVAIMHAGGPAP
GMNTAARAAVRLAISRGHTVVGIHNGFIGLATGDMSELAWSDVEGWAGEGGAELGTRREI
PSTRDLYAVSRALEDHHIDALLVIGGYSAYEGIYTMMTERDRYPAFRIPTVCIPASIDNN
LPGSELSIGTDTALNVIVEAMDKIKESGIASRRCFVVETMGRDCGYLALMSGIAAGAERI
YTNEDGISLDDLANDVHWLRESFAHGRRLFLAVRNENASHNYTTDFIARLLEEESHGMYD
VRQVVLGHMQQGGSPSPFDRLLANRLGYRALNLIDDELAAHQDGSWFIGVNESGMRPCSM
DTMPSLIDAAHRRPREQWWLQLRTIARMVSDEVR
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgttgatgacgagatgaggctcacccccactctccccgacggtcatggtctgcgc
attggcatcctgaccagcggtggcgacgctcagggcatgaacgctgctgtgcgggctgtg
gtgcgctctgcgctaagtgtgggagccgaggtctatgcgatatacgagggctaccaggga
atgatcgatggtggcgatggcatccgtaggttcgggtgggacgacgtcggctcgatcctc
aaccgtggcggcaccgtgatcggaaccttccgttgcaaggggatgcgcgaacgtccgggg
cgcctgaaggctgtcagaaatctcctcgaacacgggatcgatcgtctcgtcgtcatcggc
ggtgacggttcgctcaccggcctggatgtgctgcgcaccgaatggacagacctggtcgct
gaactcgtcgacaccggccaggtgagcgccgaggtagcccgggaacaccccgccctcatg
atcgccgggctcgtcggatccatcgacaatgacctcgtcggatccgatatgaccatcggt
gccgatactgctctgcaccgtattgtcgatgccatcgacgacctcgcctccaccgcggcc
agccaccagcgatccttcgtcgttgaggtgatgggccgccactgcggctatctcgccctt
atggcagcagttgccggcggagctgactatgttcttattccggaacggccgcccgaggac
ggttgggaggaccgcatgtgcgccgagctcaaacgtggccgtcaggcgggccgacgcgac
tcgatcgtcgtcgtcgcggagggcgccaccgatcgttccgggaaccggatctcctcggag
tacgtccgccaggtgcttgaggacaaactcggtgaggacgcccgggttaccatcctgggc
cacgtccagcgcggcggacgaccgtcagcctatgaccgctgggcgtcgacctggttgggt
tatcacgcggttcacgaggtgctctcgaccactccagaggccgaggggcgcgttatcggc
actgggtccaaccgcatacatcgcctccccctggtcaaggccgtcgctgacacgaagtcg
gtgcccggtctcattacggagggccgttacaacgaggccatgcggatgaggggacgttcc
tttgtcgagatggacgcgatcttcaccgaactcagtgaaccagctcgtaccacttccgac
accgctggtgacgccgaccgcaagcgcgtcgcgatcatgcacgctggcggtccggccccg
ggcatgaatactgctgcccgtgctgcagtgcgactggcgatttcccgcggtcataccgtt
gtgggaatccataacgggttcatcggactagcgaccggggacatgtcggaattggcctgg
agcgacgtcgagggctgggccggggaaggcggcgctgagctgggtacccgccgcgagatc
cctagcactcgcgacctttatgctgtcagccgcgctctggaggatcatcacatcgacgcg
ttgctcgtcattggtggctactcggcctacgaaggtatctacaccatgatgactgagcgg
gaccggtacccggctttccgtattccgacggtgtgcattccggcttcgatcgacaacaac
ctccccggttcggaactgtccatcggcaccgacaccgctctcaacgtcattgtcgaggcg
atggacaagattaaagagtcgggtatcgcgtccagacgctgcttcgtcgtcgagacgatg
ggtcgtgactgcggatacctcgcgctgatgtcgggtatcgcagctggcgctgagcggatc
tataccaacgaggacggcatctccctggacgatctagccaacgacgtccattggttgcgg
gagtcattcgcccacggacgacgacttttccttgccgtgcgcaacgagaacgcatcgcac
aattacaccaccgacttcatcgcgcggctgctggaggaggaatcacacggcatgtatgac
gtacgccaggtggtactagggcatatgcagcaaggcggctcaccctcacctttcgaccgc
ttgctcgccaaccgactcgggtatcgcgctctcaatctcattgacgacgagttggcggcg
catcaggacggttcatggttcattggcgtcaacgagtcgggcatgcggccctgttcgatg
gacaccatgccctctctcattgacgccgctcatcgtcgtccccgcgaacagtggtggctg
caactgaggactattgccaggatggtctcggacgaggtgcggtaa

DBGET integrated database retrieval system