KEGG   Phanerochaete carnosa: PHACADRAFT_121497Help
Entry
PHACADRAFT_121497 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pco  Phanerochaete carnosa
Pathway
pco00250  Alanine, aspartate and glutamate metabolism
pco00410  beta-Alanine metabolism
pco00430  Taurine and hypotaurine metabolism
pco00650  Butanoate metabolism
pco01100  Metabolic pathways
pco01110  Biosynthesis of secondary metabolites
Module
pco_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PHACADRAFT_121497
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PHACADRAFT_121497
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHACADRAFT_121497
   00430 Taurine and hypotaurine metabolism
    PHACADRAFT_121497
Enzymes [BR:pco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PHACADRAFT_121497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18907908
NCBI-ProteinID: XP_007396035
JGI: Phaca1_121497
UniProt: K5UZV1
LinkDB All DBs
Position
Unknown
AA seq 537 aa AA seqDB search
MAGERIGGLCSRQDNHAVHGHRNHLHSSNGHHLVSPYGARYGTETVPKFSLPRKGSDAKA
AYQLIHDELTLDGSPGLNLASFVHTWMPEEANKLMMENISKNLIDQDEYPMTQKIHTRCI
SILASLWNAPDSHNAIGTATTGSSEAIQLGGLAMKRIWQEKRKAAGKSIHEPGPNIVMGA
NAQVALEKFARYFEVECRLVPISKESSYCLDPKKAMEYVDENTIGVYVILGSTYTGHYEP
VKAMSDLLDEYEARTGHSVPIHVDGASGAFVAPFANPKLLWDFRLPRVVSINTSGHKFGL
AYVGVGWVVWRGKDFLPKDLIFELHYLGSVEYSFSLNFSRPAHPIIAQYFNFLHLGFEGY
KAITLDDMKNARLLSRALENSGLFEVLSDIHRPVEGLAASIKGAVSFDEENIDNYIPGLS
VVAFRFSEEYRAQNPDVKQKWVQTLLRAKGWIVPNYELAPDLENIEILRVVVRESVTADM
IDGLVGDLVEVADQLAQTDSPVHALAALGNKHSTEAHHGKLPDGHGSKSNGTYARTC
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgagcgtatagggggcttatgcagtcgacaggataaccatgctgtgcatgga
cacaggaaccatctccacagctcgaatgggcaccatttagtaagcccatacggggctcgc
tacggcactgagactgttcccaagttcagtttaccccgcaagggatccgacgcgaaggcc
gcgtaccagctcatccatgatgagctcacgctcgacggctcgcctggcttgaacctcgca
tccttcgtccacacctggatgcctgaggaggccaacaagctcatgatggagaacatatcg
aagaacttgatcgaccaggacgaataccccatgactcaaaagatccacacgcgctgcatc
tccatccttgccagcctttggaacgcccctgactcgcataacgcgatcggtaccgcgacg
accggctcctctgaggctatacaacttggtggccttgcgatgaagcgcatctggcaagag
aagcgcaaggcggcgggcaagtccatccacgagcccggtccgaacatcgtcatgggtgcc
aacgcccaggtcgcactcgagaagttcgcgagatacttcgaggtcgagtgcaggcttgtg
cccatttccaaggagagcagctactgcctcgatcccaagaaggcgatggagtatgtcgac
gagaacactattggtgtctacgtcatccttggaagcacttacactggtcactacgagcct
gtgaaggcgatgtctgatcttctcgacgagtacgaagctagaactggccattccgtcccc
atccatgttgatggtgcctccggcgctttcgttgcgcctttcgccaacccgaagctcctg
tgggactttcgccttccgcgtgtcgtctccattaacacttccgggcacaagttcggactg
gcatacgtcggtgtcggctgggttgtctggaggggcaaggactttctgccgaaggacctc
atcttcgagctgcactacctgggatcggtcgagtattcgttctcgctcaacttctcgcgt
ccggcgcacccgattatcgcgcaatacttcaacttcttgcatctcgggttcgagggttac
aaggcgatcacgctcgacgacatgaagaacgctcgtctgctcagccgagcgttggagaac
agtggcctgtttgaggttttgagcgacatccaccgcccggttgagggcttggcggctagc
attaaaggtgccgtctcgttcgacgaggagaacatcgacaattacatacccggtctttcg
gtcgtcgctttccgcttctctgaagaataccgcgcccaaaatcccgacgtgaagcagaaa
tgggtgcagaccctcctgcgcgccaagggctggatcgttccgaactacgagctcgccccc
gacctggagaacatcgagatcctccgcgttgtcgtgcgcgagagcgtcacggccgacatg
atcgacggcctcgtcggagaccttgtggaggtcgccgaccaactcgcgcagacagactcg
cctgtgcacgcgttggccgcactcgggaataaacactcgactgaggcgcaccacggcaaa
ctccccgacggccacggaagcaagtccaacggtacctatgccaggacgtgttag

DBGET integrated database retrieval system