KEGG   Phanerochaete carnosa: PHACADRAFT_162874Help
Entry
PHACADRAFT_162874 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pco  Phanerochaete carnosa
Pathway
pco03030  DNA replication
pco03410  Base excision repair
pco03420  Nucleotide excision repair
pco03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pco00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PHACADRAFT_162874
   03410 Base excision repair
    PHACADRAFT_162874
   03420 Nucleotide excision repair
    PHACADRAFT_162874
   03430 Mismatch repair
    PHACADRAFT_162874
Enzymes [BR:pco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PHACADRAFT_162874
    6.5.1.6  DNA ligase (ATP or NAD+)
     PHACADRAFT_162874
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PHACADRAFT_162874
DNA replication proteins [BR:pco03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PHACADRAFT_162874
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PHACADRAFT_162874
DNA repair and recombination proteins [BR:pco03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PHACADRAFT_162874
   NER (nucleotide excision repair)
    Other NER factors
     PHACADRAFT_162874
   MMR (mismatch exicision repair)
    Other MMR factors
     PHACADRAFT_162874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 18909238
NCBI-ProteinID: XP_007397175
JGI: Phaca1_162874
UniProt: K5VSL3
LinkDB All DBs
Position
Unknown
AA seq 790 aa AA seqDB search
MLGHKHFTASSTLAGPSKPVARASPEIIDVDLLEDPEHGETAVSGSGKKSNRPVAPRTPV
SDEPGLSKTEAAIYPPLDVDPVAYSLDKCPWQRKSAPYSFLAHGLATLSSTKSRIAIMNV
LTNTLRAIIKFHPISLCPALYLLSNTLAPPYTPIELGLGPSIMSKAIQDVSGLTSAALRR
LYNSTGDPGDVAFEAKSNVRTLVPHPSLLIVGVYDSLLKIAQSKGTGAAKAKQSIVQKLL
VSAKGEETRYLVRTLGQNLRVGAVRTSILTALARAMVLTPPASIQSAGSASYASDALLAE
IKPLPAGSKKKMADTARDDLLEKFTRAEAVIKKAYVLHPNYDHIAAALVDVGLDGLAERL
PLTVGIPLLPTLGSPVRSLDEVYDLLGSQPFSAEFKYDGQRAQIHAARRSQGSNIVKIFS
RHLEDMTDKYPDVSSLVQDIFANSQETESFILDAEIVAIDPVDGSLKSFQELSNRARRDV
KLDDVKVSVSVFAFDLMYLNGEILLERPFRLRRSLLRTVFPPVVPDSTSAAQFQHVQSCE
SADGREAVEQFWQEAVSSRSEGLMIKLLDSGLVTEDNKSRRKPLPATYEPDKRTAAWLKL
KKDYVTGLGDSLDLVPVGAWHGNGRKAQWWSPILLAVWDPSTGKLVAVCKCMSGFSDAFY
KELKERYLEDSETCSRQPQWNYEVLTGGLKPQVYFKPQEVWEIRGADITISPVSVAALGM
VSEARGLSLRFPRFIRVHDDKAVENASTPEFLANMYRSQQGKDRSGVDDGDLVDVDMQES
EAEDAYDSDG
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgctcggacacaagcactttacagcttctagcacgctagctggtcccagcaagcctgtt
gctagggcgtcacccgaaattatcgatgtcgaccttctcgaggaccccgaacacggtgaa
actgccgtctctggctcggggaagaagtctaacagacccgttgcgcctcgaacaccagtc
tcagacgaacctggcttgtcaaagacagaagcagcaatctaccctccattagatgtggac
cccgttgcctattctctcgataaatgcccgtggcagcgcaagtctgcaccgtattcgttt
ctagctcatggactcgcaacgctttcgagcactaaatcgcgcatagcgatcatgaacgtg
ctgacgaacacacttcgtgccatcatcaagttccaccccatatctctctgccctgcgttg
tatctcctctctaatacgctagcaccgccttacacccctattgaattaggcctgggccct
tccatcatgtctaaagcaattcaggacgtctctggtttgacttcggccgctctacggcgc
ctctacaattcaaccggagatccaggcgatgtcgcctttgaggccaagtcgaacgttcga
acgttggtcccccatccatcgctactgatcgttggggtttatgactcgctgctcaagatt
gcgcaatcgaaaggcacgggcgctgcgaaggccaaacagagtatcgtccagaagctcttg
gtttcggccaaaggcgaggagactcgttatctagtgcggaccctgggccagaacctgcgg
gtgggtgccgtgcgcacgtcgatcctcacagcactcgcacgagcaatggtcctgacaccg
cccgcgtccattcaatcggctggctccgcatcctatgcctcagacgcgctcctggccgag
ataaaacctcttccggcgggttcaaagaagaagatggcggacacggcaagggatgatctg
ctggaaaagttcactcgtgcggaggcagtcatcaagaaagcctatgtgctacacccgaat
tacgaccacatcgccgcagctcttgttgacgttgggctggacgggctagctgaacgcctg
cctttgacagtgggaatacctctccttccaactctgggctcgcccgtgcggtcgctagac
gaagtatatgacctattaggatcacagccgttcagcgccgaatttaaatacgacggacag
cgggcgcagatacacgccgcccgacgatctcaaggatcaaacattgtgaagatcttctca
cgacatcttgaagatatgactgacaagtaccctgacgtctcctcccttgtccaagatatc
tttgcaaattcccaagaaaccgaatcgttcatactcgatgcagagattgtggccattgat
cccgtcgacggcagcctcaagtccttccaagagctgtcgaatagggcacgaagggacgtg
aagctggacgacgtaaaggtgtcagtttctgtcttcgcatttgacttgatgtacttgaat
ggggaaatcctccttgaaaggccgtttcggctgcgtaggtcgctccttcgcaccgtcttt
ccgcccgtggtgccggatagcacgagtgctgcgcagttccagcacgtgcagagctgtgag
agcgcggacgggagggaagctgtggagcaattctggcaagaggctgtgagcagccgtagt
gagggtctcatgatcaagctattagattccggcctggtgacggaggacaacaaatcgagg
cggaaacccctgcccgcaacgtacgagcccgataagcgcacggcggcatggcttaagctg
aaaaaggactatgtcaccgggctcggggacagtcttgacctcgtgccagtcggcgcatgg
cacgggaacgggcgcaaggcacagtggtggagtccgatccttctggcagtctgggacccc
tccacgggaaagctcgtcgcggtttgcaaatgcatgtcaggattttccgatgcattctac
aaggaactcaaggaacgatatctcgaagattcggagacatgttcaagacagccacaatgg
aactacgaggttctgacaggcggactgaagcctcaagtgtacttcaagccgcaggaggtg
tgggagatccggggagcggacattactatcagccctgtctccgttgcggctctgggaatg
gtgtctgaagcgcgcggcttgagcctgcggtttcctcgtttcatcagggtgcacgacgac
aaggcggtggagaacgccagcactcccgagttcctcgcaaacatgtaccgctcgcagcaa
ggcaaggaccggagcggagtggacgatggcgatcttgtcgacgttgatatgcaagagtct
gaggcagaggacgcgtacgactcagatggttag

DBGET integrated database retrieval system