KEGG   Phanerochaete carnosa: PHACADRAFT_178599Help
Entry
PHACADRAFT_178599 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
pco  Phanerochaete carnosa
Pathway
pco03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PHACADRAFT_178599
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pco03400]
    PHACADRAFT_178599
Enzymes [BR:pco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PHACADRAFT_178599
DNA repair and recombination proteins [BR:pco03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     PHACADRAFT_178599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C RNA_ligase BRCT LIG3_BRCT PTCB-BRCT
Motif
Other DBs
NCBI-GeneID: 18909857
NCBI-ProteinID: XP_007401169
JGI: Phaca1_178599
UniProt: K5VFN0
LinkDB All DBs
Position
Unknown
AA seq 1036 aa AA seqDB search
MQQATPAPSYHRPSPPPGASTVHSTATADDHPVEYPVPPQNDGSAPFYVLSALFDRLQNE
RKPDKRRRLLATWFNHWREDKGYDLYPILRLILPQKDRERAVYGLKEKALAKIYIRMIPL
QKQDRDAIRLLNWKKPADKEASAGDFPTVLYEVISKRSSVIQGSLSVEDVNDVLDELAKN
GGKSEPQVKIMTRVYNSMTAEEQRWLVRIILKDMVISVKETTVFSVFHPDAHDLFNTCSD
LKKVAWELWDPQRRLNEEEKTVHLFRAFAPMLCKRPTRRIEESVKDMGGSKFVIEEKLDG
ERLQLHKRGNEYFYCSRKGKDYTYLYGKHVGSGSLTPFIEDAFDPRVEEIILDGEMLVWD
PVSERNLPFGTLKTAAGDKTNKELRPRPCFKVFDLLHLNGQSLLQKSLKFRKNNLRACLS
EVKGRLEFVTEFEGKTAQDVRQYMEIIMNNRGEGLIMKHPGSEYVLNGRNKDWIKVKPEY
MDNMGETVDVLVVAGCYGTGRRSGGVSTLVCAVLDDQRAAGDDDGMKYRTFVRIGSGLTF
ADYVWIRQKPWKEWNPKQPPPWLLTAKRGQEDKGDAYLKPEDSFIIKVKAAEITPTDQYH
IGYTMRFPRAMMIREDLGIEDCMTASAVFESVRSEKKRKAESGGGGSKKKRKATAKKPTV
LPHFNVAEDLKDVKVEGELFKEFTLLVASDPKSRTGESDRKELMKLIKANGGKFCQVINN
RQGENTMAVYDGATIPYDIKMIVDRGTHDIVKPEWIRDSVARDELAPLTKKYLFFATEAR
RNTEEYSLAEGADVEMEEAVAGAPPSPTASSETEPETEELTRARDEPKEEADPTLSEWFK
ISAKDVHRGKVAAQEEEVESETEPESDNEDVRDKNAEIDELADEMGDDWFEVSALGSAEP
DISESSTQASELAKMGETEEAMEYDQELIFKHLCFYLDSPSNARTNGMVVKAKGAEDLDV
HFNELARKIRANGGKVTDSLDETKLTHVVLDKRDTSRRAELNKRTSKPKRRHLVVTDFIE
ACLEEDTLLDEDSFAP
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagcaactccggcaccgtcatatcatcgcccgtcgccacctccaggagcaagc
acggtgcattctacggccaccgcagatgaccatccagtcgaataccccgtgcccccgcag
aacgacgggagcgcgcctttctatgtgctgtctgccctgttcgacagactgcagaatgaa
cggaaacctgacaagcggcgaaggctcctcgccacgtggttcaatcactggcgggaagac
aagggatacgacttgtaccccattttaaggctcattttgccccagaaagatcgagagcgt
gcagtctacgggcttaaggagaaggctctggctaagatttacatcaggatgattcctttg
cagaaacaagaccgggatgctatcaggcttctgaactggaaaaaacccgcagacaaggag
gcttcggcgggagactttccaactgtcctctatgaggtcatcagcaaacggtcttctgtc
atacagggctcgctctctgtcgaggacgtgaacgatgttcttgacgagcttgccaagaac
gggggcaaatctgaaccacaagtgaagatcatgacccgagtctataacagcatgactgca
gaagaacaacgatggttagtccgaattatcctcaaagacatggtaatttcagtaaaggaa
acgaccgtgttctccgtattccatcccgatgctcatgatctcttcaatacctgctctgat
ctcaaaaaagttgcatgggaattgtgggatccgcagcgcaggcttaatgaagaggaaaaa
accgttcatctctttcgtgcgtttgcacctatgctctgcaagcgtccaaccaggcgcatc
gaagagtctgtcaaagacatgggcggaagcaagttcgtcatcgaggagaagctcgatggc
gagcgcttgcagctacacaaacgcggtaatgagtatttctactgttccaggaaaggcaag
gattacacctacttgtacggcaaacacgtcggatcgggtagtttgacccctttcattgag
gacgcatttgatccaagagtagaagaaatcatcttagatggggagatgctcgtatgggac
ccggtgtctgagcgaaatcttcccttcggaacgctgaagacggctgcgggagacaagacc
aataaagagttacgcccgcgaccatgcttcaaagtcttcgatctactacatttgaatggg
cagagtcttctgcagaagtccctaaaattccggaaaaacaaccttcgtgcatgtctgagc
gaagtcaagggtcgcctggagttcgtcacggaatttgaaggcaagacggcacaagacgtc
cggcaatatatggagattatcatgaacaatcgtggcgaggggctcatcatgaaacatccc
ggctccgaatacgtccttaacggacgaaacaaggattggatcaaagtcaaacctgagtac
atggataacatgggtgaaaccgtcgacgtgctggttgttgccggctgctacggtacgggt
cgacgctctggcggcgtttctactctcgtgtgcgcggtgctcgatgatcagcgagctgcg
ggagatgatgatggcatgaagtatcgcaccttcgttcgcattggatctggcctaacgttt
gcggattacgtctggattcgtcagaaaccatggaaggaatggaacccaaagcagccacct
ccctggctgctgactgcgaagaggggtcaggaagataagggcgatgcctatctaaagccg
gaagattcattcattatcaaggtcaaggccgcagagatcactcccacggatcaataccac
ataggctataccatgcgctttcctcgcgctatgatgattcgtgaagacctcggtatcgag
gactgcatgactgctagtgcggtcttcgagagtgtccgctccgaaaagaagcggaaagca
gaaagtgggggtgggggttcaaagaagaagcgcaaggcaaccgctaagaagcctactgta
ttgcctcacttcaacgtcgccgaggatctgaaagacgtcaaggtagaaggcgagctgttc
aaggagtttactttattggtggcgtccgatccgaagtccagaacaggtgaaagtgacaga
aaggagctcatgaaactgatcaaggcgaatggcggcaaattttgtcaagttatcaataac
cggcagggagagaacacgatggctgtgtacgatggtgcgactattccctacgacatcaag
atgattgtggacaggggaactcatgacatcgtcaaacctgaatggatcagagacagcgtt
gcaagggacgagttggcacctctaacgaagaagtatctcttcttcgctacggaagcccgt
cggaatactgaggaatatagcctggcggaaggtgctgacgttgagatggaggaagcagtc
gcaggtgctcctccatcaccgactgcgtcatccgagacagaaccggagacggaggagctg
acgcgtgctcgggatgagccaaaagaggaagccgatcccaccttgtccgagtggttcaag
atcagtgcaaaggacgtacataggggaaaggtggcagcacaagaggaagaagttgagagc
gagaccgagccagagtcggacaatgaagatgtgcgcgacaaaaacgctgagattgacgaa
ttagcagacgagatgggggacgactggttcgaggtttctgccctcgggagtgccgagcct
gatatcagcgagtcatcgacgcaagcctccgaacttgccaagatgggagaaactgaggaa
gctatggaatacgaccaggagctgattttcaagcacctatgtttttatcttgattctcca
tcaaatgccaggacgaatggtatggtcgttaaggccaagggtgcagaggatctcgatgta
catttcaacgagcttgcgcgcaagatcagagcaaatggcggcaaggtcaccgacagcctc
gatgagacgaagcttactcacgtcgttttggacaagcgggacacttctcgacgtgccgaa
cttaacaagcggacatcgaagccgaagcgcagacatctcgtcgtcaccgacttcatcgaa
gcttgtcttgaggaagacaccctgctggatgaagattcttttgctccttag

DBGET integrated database retrieval system