KEGG   Phanerochaete carnosa: PHACADRAFT_187379Help
Entry
PHACADRAFT_187379 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
pco  Phanerochaete carnosa
Brite
KEGG Orthology (KO) [BR:pco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pco03036]
    PHACADRAFT_187379
Enzymes [BR:pco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PHACADRAFT_187379
Chromosome and associated proteins [BR:pco03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PHACADRAFT_187379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18910422
NCBI-ProteinID: XP_007399796
JGI: Phaca1_187379
UniProt: K5WNV7
LinkDB All DBs
Position
Unknown
AA seq 572 aa AA seqDB search
MLRVYLQEACLRHQFIRSKETSNVVERPQRLRAVNVGLAAVMARTSQGRRKVEPVSQDAK
DEPEDELVSAIGRLNIAQVNDRTLAAGPIEVVKSSAKVDLLNNAAVKFIHGDIEGDVYLE
KLIKLSKESRDKIAAGESEIPGGLSQGDLYLCPESVDSIQGALGTMCEVVDRVMDPWSST
SRAFVAVRPPGHHCGEDTPSGFCFVNNVAIAAAHGKVSATHLEYNITRVAIFDIDLHHGN
GTQSIIWQINEEAYRAQLEEPDGKSPDKTRLQVFYGSLHDILSYPCEDGKLDLVQAASVS
LHGPHGQFVENIHLEPYTTEKHFFESLYEKKYLRLLQKARSFIDDTGGVRDDTLVFISCG
FDACEHEYESMSRHGRKVPTSFYHRFARDARLFADSVAKGKLISVLEGGYSDRALTSGTI
AHLSGLAETDDVKADPEWWTLDNLVALEKATAKRRGGQQAVTEMEPWLERTLEYFIQINS
DPLLAAPPMIMSLRDRSNKKTTTAPVPAAPKVAKNKPKEKALVKQAAAETSRSDTERSAD
EANADTLPKKPRRVVLKLGPNPVAGNSSARES
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgctcagagtgtatctgcaagaagcgtgtttacggcaccaatttattcgctcgaaggag
acttcaaatgttgtagagaggccacagcgtctgcgcgccgtgaatgtcgggctcgcagcg
gttatggccaggacgtcgcagggtcgtcgcaaagtggagcctgtaagccaggatgccaaa
gacgagcccgaggacgaactggtctcggccatcggtagacttaacatcgcccaagtcaat
gaccgtactttggcggccgggccgatcgaggtagtcaaaagctcggcgaaagtcgatctc
ttgaacaacgctgcggtcaagttcattcacggagatatcgaaggagatgtctacctagaa
aaactgataaagctctccaaagaaagcagagataagattgcagcaggcgaaagcgaaatt
ccgggagggctttcgcagggtgacctctacctttgtccggaatcagtagactcgatacag
ggcgcacttggaacaatgtgtgaagtagtggaccgtgttatggacccgtggtcatccaca
tcaagggcgttcgttgctgtccgtcctccgggccatcattgcggtgaggacaccccctcc
ggcttctgcttcgtgaacaatgttgcaattgccgctgcccacggtaaagtgtctgcaacc
catctcgaatacaacattactcgcgtggctatattcgatattgatcttcaccatggaaac
ggcacacagtcgataatatggcaaataaacgaggaggcataccgcgcccagcttgaagag
ccggatggcaaatctccggacaagacaaggttacaggttttctacggcagtctgcacgac
attctgtcatacccttgcgaggatggcaagctggatctcgttcaggctgcgtctgtttca
ctacatggcccacacggccaattcgtcgagaacatccatcttgagccatatactacggaa
aaacacttcttcgaaagcctgtacgagaagaagtacttacgccttctgcagaaggcacgg
agcttcatcgacgacactggcggcgtcagagatgacactttagtttttatcagctgtgga
tttgatgcgtgcgagcacgagtacgagtcgatgtcaaggcacgggcgcaaagttcccacg
tctttctaccatcgcttcgcccgtgacgcacgtctgttcgcggattccgtggcgaagggg
aagcttatcagcgtgctggaaggtggttacagcgatcgcgctttgacgagcggcactatt
gcacatctctccggactggcggaaaccgatgacgtcaaagccgaccctgagtggtggacg
cttgacaacctcgtcgctcttgagaaggctaccgcgaaacgtcgcggcgggcaacaagcc
gtcaccgagatggaaccttggctagagcgcacgctcgagtactttatacagataaattcg
gatcctctgcttgctgcaccaccgatgatcatgtccctccgcgatcgctcaaacaagaag
actacaactgcgccggtgcccgcagcgccaaaagtcgccaagaacaagccgaaggagaaa
gcgttggtcaagcaggcagcagcagaaacatctcggtctgatacagaaaggtccgctgac
gaggccaatgcggacacattaccgaagaaaccacgcagagtcgtattgaaactcggtcca
aatcctgtagcggggaactctagtgcacgcgaaagctga

DBGET integrated database retrieval system