KEGG   Phanerochaete carnosa: PHACADRAFT_203521Help
Entry
PHACADRAFT_203521 CDS       T03128                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pco  Phanerochaete carnosa
Pathway
pco00052  Galactose metabolism
pco00500  Starch and sucrose metabolism
pco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PHACADRAFT_203521
   00500 Starch and sucrose metabolism
    PHACADRAFT_203521
Enzymes [BR:pco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PHACADRAFT_203521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF1702
Motif
Other DBs
NCBI-GeneID: 18912183
NCBI-ProteinID: XP_007389752
JGI: Phaca1_203521
UniProt: K5VBJ8
LinkDB All DBs
Position
Unknown
AA seq 969 aa AA seqDB search
MLSAVLAGLLLPAVVLGREPSKLQRDALPHQFAPRAPTLSLNVSSCPGYTLSALQETDTG
LAAQLNLAGAACDAFGQDIANLTLEVTYDSDTRLHVNIFDTANSQFTIPSSVIDLPGKPT
SIHKNSSDLVFNYEPSPFAFWITRRSEPDAQPLFDTRISSLPPTPIPPVISTDNSTALDG
FPLVFEDQYLQLTSALPLGTNIYGLGEVVASSGFRRDVGTDGGVGTIQTMWARDIADPID
QNVYGSHPIYLEHRYNATTKRSQTHGVFLFSSSGSDILLLTPPSSNVSLVEYRLIGGTLD
LYFFSGPSPQEVIEQYGALVGLPTWQPAWGFGFHLCRWGYFSLNETREQVQRMRDADIPL
EVMWNDINLYHAVRDFTADPVSFPPEEMRTFIRELAANNQHYIPIVDAAVAKQVNDTDIY
DPYTRGAELDVWIKNPDGSEYVGQVWPGYTVFPDWFANNTQQYWTEALTNWSGLGIEFSG
IWLDMNEASSFCDGSCGTGADLSNTTVPFFLPGMPGALVTDYPEGYNVAVWGPSGNMTIN
GTLTYDVNTTTGSALARRGVGAGNQTGVDLNTPPYAIHNGNGRLSLHALATNATHAGGYA
ELDVHNLWGTMEERATHLALQSLHPGKRPFIIARSTFPSAGTWAGHWLGDNFSKWQYMYL
NIQGVLQFQVFQVPFVGADTCGFNGNTDEELCARWMQLSAFVPFYRNHNEQGALSQEPYR
WDSVANASRTAMAVRYAMLPYWYTLFANASRYGTPPVRALWYEFPDEPELFAVDRQFLVG
RDILITPVLTPNVSTVDGIFPGQGRTTWRDWYTHAAVDAAISANTTLAAPLGHIPVHVRD
GSVLLLHATPGYTIAETQQSPYTLLVAQAADGYAFGTAYFDDGESIPPTPHRDAQFHVAK
GQVSITSTGTYEVGQKLESVTVLGTDKPVNVTVNGEAVQSWQYLAVQQELVVSGLAVDLN
APATTISWQ
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccgcagtccttgctgggcttctgctgcccgcggtcgtgctgggccgagagccg
tccaagcttcaacgtgatgcgcttccccatcaattcgcaccccgagcgcccacgctttcg
ctcaacgtctcgagctgccccggctatactctgagtgcgctgcaagagacagacactggg
ctggccgctcagctcaacctggccggcgctgcttgcgacgcatttgggcaagatattgca
aatttgaccctggaagttacttatgattctgatacgaggctgcacgtgaacatctttgac
actgcaaattcccaattcaccatcccatcttcggtaatcgaccttccgggaaagccgact
tccattcacaaaaacagctccgacctcgttttcaactacgaaccctctccatttgcgttc
tggatcacccgccgttccgagcccgatgcgcagcccctgttcgatacccggatctcgtcc
ctgccgcctacgcccatcccgcccgtgatctcgacagacaactccactgccctcgacggc
ttcccgctcgtgttcgaagaccaatatctgcagctcacgtctgcgcttccactcgggacg
aacatctatggcctgggagaggtcgtcgcgagcagcggcttccgcagagatgtcggcaca
gacggcggcgtcgggacgatccagacgatgtgggcgcgggatattgctgatcccatcgac
cagaacgtctatggctcgcacccgatctacctagagcaccgctacaacgccacgaccaag
cgttcacagacgcacggcgtcttcctcttcagctcttccggctccgacatcctcctcctg
accccaccgtcgtccaacgtctcactcgtcgagtaccgcctgatcggcggcaccctcgac
ctctacttcttctccggcccgagcccacaggaggtcatcgagcagtacggtgcgctggtt
ggtctaccgacgtggcagcccgcctggggcttcgggttccacctgtgccgctggggctat
tttagcctgaacgagacgcgcgagcaggtgcagcgcatgcgtgatgcggacatcccgctc
gaagtgatgtggaatgatatcaacttgtatcatgcggtgagggactttacggcggaccct
gtgtcgttcccgccagaggagatgcgcacgttcattcgtgaactggccgctaacaaccag
cactacattccgatcgtcgatgccgcagttgccaagcaagtcaacgacacagacatttac
gacccctatactcgtggagccgaacttgacgtctggatcaagaaccccgacggcagcgag
tacgtcgggcaggtctggcccggctacaccgtcttccccgactggttcgccaataatacg
cagcaatactggacagaggcgctcacgaactggagcggcctcggcatcgagttctccggc
atctggctcgacatgaacgaggcctcgagcttctgtgacgggtcctgtggcaccggcgcg
gacctgtcgaacacgacggtgccgttcttcctgccgggcatgccgggtgcgctggtgacg
gactacccagaagggtacaacgtcgcagtctggggcccgagcggcaacatgacgatcaac
ggcacgctcacatacgacgtcaacaccaccaccggctccgcactcgcccggcgcggcgtc
ggcgcgggcaaccagaccggcgtcgacctcaacaccccgccgtacgcgatccacaacggc
aacggccgcctgtcgctgcacgcgctcgcgacgaacgcgacgcacgcgggcgggtacgcc
gagctcgacgtgcacaacctgtggggcacgatggaggagcgcgcgacgcacctcgcgctc
cagtcgctgcacccgggcaaacggccgttcatcatcgcgcggagcacgttcccgtccgcg
ggcacgtgggcggggcactggctcggcgacaacttcagcaagtggcagtacatgtatctt
aatatacagggcgtgctgcagttccaggtgttccaggtgccgttcgtcggcgcggacacg
tgtgggttcaatgggaacacggacgaggagctctgtgcgcgctggatgcagctcagcgcg
ttcgtgccgttctacaggaaccataacgagcagggcgcgctgagccaggagccgtaccga
tgggacagcgtcgcgaatgcgtcgaggaccgcgatggccgtgcggtacgcgatgttgccg
tattggtacactctgtttgcgaacgcgtcgcggtacgggacgccccccgttcgtgcgctg
tggtacgagttccccgacgagcccgagctcttcgcagtcgacaggcagttcctcgttggc
cgcgacatactgatcacgccggtgctgacgccgaacgtctcgaccgtcgacggcatcttc
cccggccagggccgcacgacgtggcgcgattggtacacgcacgccgccgtcgacgccgca
attagcgcgaacacgacgctcgcggcgccgctcggccacatccccgtgcacgtccgcgac
gggtccgtgcttctgctgcacgccacgcccgggtacacgatcgcagagacgcaacagagc
ccgtacacgctcctcgttgctcaggccgccgacgggtacgcgtttggcaccgcctacttt
gacgacggcgagagcatcccgccgacgccgcaccgcgacgcgcagtttcacgtcgcaaag
ggtcaggtcagcatcacgagcaccgggacgtacgaggtggggcagaagctcgagagcgtg
accgtgctcgggacggacaagcctgtgaacgtaacggtgaacggggaggcggtacagagc
tggcagtacctcgccgtgcagcaggagctggtcgtgagcgggctggcggtggacttgaat
gcgccggcgacgacgatttcgtggcagtag

DBGET integrated database retrieval system