KEGG   Phanerochaete carnosa: PHACADRAFT_204217Help
Entry
PHACADRAFT_204217 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pco  Phanerochaete carnosa
Pathway
pco03030  DNA replication
pco03410  Base excision repair
pco03420  Nucleotide excision repair
pco03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PHACADRAFT_204217
   03410 Base excision repair
    PHACADRAFT_204217
   03420 Nucleotide excision repair
    PHACADRAFT_204217
   03430 Mismatch repair
    PHACADRAFT_204217
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pco03032]
    PHACADRAFT_204217
   03400 DNA repair and recombination proteins [BR:pco03400]
    PHACADRAFT_204217
Enzymes [BR:pco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PHACADRAFT_204217
    6.5.1.6  DNA ligase (ATP or NAD+)
     PHACADRAFT_204217
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PHACADRAFT_204217
DNA replication proteins [BR:pco03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PHACADRAFT_204217
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PHACADRAFT_204217
DNA repair and recombination proteins [BR:pco03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PHACADRAFT_204217
   NER (nucleotide excision repair)
    Other NER factors
     PHACADRAFT_204217
   MMR (mismatch exicision repair)
    Other MMR factors
     PHACADRAFT_204217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 BURP
Motif
Other DBs
NCBI-GeneID: 18912260
NCBI-ProteinID: XP_007390501
JGI: Phaca1_204217
UniProt: K5XDG3
LinkDB All DBs
Position
Unknown
AA seq 843 aa AA seqDB search
MGRQTTLEKYIDVSKGMKPAPPQQSTLGEMWGKKKKREPEVKVAQENNMDVEDTSERSKR
KQASSAQSGAAPEQPPKAKKRRIIASDDEDDLPTIAKSDVAMSSEAELVPPSDEDEDSGP
SKPKRKAAKPSKVKNDRKVKSKGKAKAAVIAEEDKEGQDAKSSSASSGDEAPEQDIDEGE
EETDEEEATQNIEAVLSKTKEVDIEGGWELGHPIPYAALAKVFGLIEGTTKRLEKTSLLT
SFLLLVIQRSASGDTDSLLQSVYLCINRLCPDYVGIELGIGESLLLKAIAESTGRSMTVI
KQDLKKEGDLGLVARNSKNAQKTLFKPKPLTVPFMFKNLKEIASSTGHSSQNKKVSIITK
LLAACQGEEAKYIIRSLEGKLRIGNAERTVLVALAHAAILAEQEKATKRLNQEKLTGRLE
HAAEVVKSVYSELPSYDLVIPALLEVGIDGLKERCKLTPGVPLKPMLAKPTKAIGEVLDR
FEGKKFTCEYKYDGERAQVHKLDDGTVAVFSRNSEDMSKKYPDLMDQLPRCMKSTAKSFV
LDAEAVAVDRKTGQLKPFQELSKRKRKDVKVEDIEIWVCLFGFDLLYLNGESLLHHPFAE
RRELLGTHFQEVEGEFTFAKSKDCETTEEIQAFLEESVKDGCEGLMVKMLETEASHYEPS
RRSVNWLKLKKDYLAGVGDSLDLVVVGGYYGKGKRTNVYGAFLLACYDADGEQYQTICKI
GTGFSDEALQQHHELLKPLELTKPRGDIKVGGAKPDVWFEPKVVWEVLTADLSLSPVYTA
AQGLADERGISLRFPRFIRVRDDKGADDATGPEQIAEMYERQVLAQSKGGKKKKGGDADD
EFW
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggcagaccaccttagagaaatatatcgacgtatcaaagggaatgaagccagca
ccaccgcaacagtccacgctcggggagatgtggggtaagaagaagaaacgcgaacccgag
gtgaaagtcgcgcaagagaacaacatggatgtcgaagatactagtgaaagatctaagcgg
aaacaggcatcttctgcacagtcgggggccgcgccagagcagcctccgaaagcaaaaaaa
cgcagaatcatagcctcggacgatgaagatgacctgcctaccattgcaaagtcagatgtg
gccatgtcgtccgaggcagagctcgtgccaccgtccgacgaggacgaggattcaggaccc
tcgaaaccaaagcgcaaagcagcgaagccttcgaaagtgaagaacgacaggaaagtcaag
tcgaaaggcaaggctaaggccgcggtgatagcggaagaagacaaggaagggcaggatgcc
aaatcttcttccgcgtcaagcggggacgaggcaccggaacaagatatcgatgagggggag
gaagagactgacgaggaggaggctacccaaaatattgaggcagtgttatcgaagacgaaa
gaagtcgatatcgaaggcggatgggaattaggacaccctattccgtacgccgctttggcg
aaagtcttcgggctgatcgagggcactaccaaacgactagagaagacttctctgctaacc
tcatttctactgcttgtcattcaacggagtgcttctggtgacactgattctttacttcaa
tcggtatatctctgcatcaatcgactgtgcccagactacgtgggcattgaactcggcata
ggcgagagtttgctgctcaaggccattgctgagtcgacgggtagaagtatgacagtcatc
aaacaagacttgaagaaagaaggtgacttgggtcttgtcgccagaaactctaagaacgct
cagaagactctgttcaagcccaaaccgctcacagtacccttcatgttcaagaatcttaag
gaaattgcgtccagcactggtcactcttctcaaaacaagaaagtctccattatcaccaag
cttttggctgcttgccaaggggaggaggcgaagtacatcatccgttccttggaaggcaag
ctgcgtatcggtaatgctgagcgcaccgtgcttgtcgcgttggcgcatgcagcaatcttg
gctgagcaagaaaaagcaaccaagaggctgaaccaagaaaagcttactggccgcctcgag
catgctgcggaggtggtcaagtctgtgtacagcgaactgccttcgtacgacctcgtgatt
ccggcactcctcgaggtcggcatagatgggctcaaagagcggtgcaagctcacgcccggc
gtgccgttgaaacctatgttggcgaaaccgactaaagccatcggcgaggtgctcgatagg
ttcgagggcaagaaattcacgtgcgagtacaagtacgatggcgagcgcgcgcaggtacac
aaactcgatgacggcacggttgcggtgttcagccgtaattcggaggacatgagcaagaag
tatccagatttgatggatcagcttcctcggtgcatgaagagtactgccaagtctttcgtc
ttggatgcggaggccgtcgctgttgaccggaagactggacaactgaaaccattccaggaa
ttgagcaaacgaaaacgtaaggacgtgaaggtcgaggacattgagatatgggtatgcctg
tttggctttgacctactctacctgaatggggagtccctgctgcaccacccttttgcagaa
cgccgcgagctgctagggacacatttccaggaggttgaaggagagtttacattcgctaag
tccaaggactgtgaaacgacggaagaaatccaggccttcctcgaagagagtgttaaggat
ggctgtgaaggacttatggtcaagatgctcgagacggaagctagtcactatgagccgagc
cggcgcagcgtgaattggctcaagctcaagaaagactacctggcaggggtcggtgactca
ctggatctggtcgtcgtggggggctattacgggaagggtaagcgtacgaacgtgtacggt
gcattcctcttggcctgctacgatgcggacggcgagcaataccagacgatctgcaagatt
ggtactggttttagcgacgaggctctgcagcagcaccatgagcttctcaagccgctggaa
ctgacaaaaccaagaggagacatcaaggtcggcggtgcaaagcctgacgtgtggtttgaa
ccgaaggtcgtctgggaggtcctgacagcagacctgagcttgagtcctgtgtacacagct
gcacagggattggcagatgaaagaggtatttccctccggttcccccgtttcatccgggta
cgggacgataagggagcagatgacgcgactggaccagagcagatcgcggagatgtacgag
cggcaagtgcttgctcagagcaagggcgggaaaaagaaaaagggcggcgacgccgacgac
gaattttggtag

DBGET integrated database retrieval system