KEGG   Phanerochaete carnosa: PHACADRAFT_209241Help
Entry
PHACADRAFT_209241 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pco  Phanerochaete carnosa
Pathway
pco00030  Pentose phosphate pathway
pco01100  Metabolic pathways
pco01110  Biosynthesis of secondary metabolites
pco01130  Biosynthesis of antibiotics
pco01200  Carbon metabolism
pco01230  Biosynthesis of amino acids
Module
pco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pco_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PHACADRAFT_209241
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    PHACADRAFT_209241
Enzymes [BR:pco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     PHACADRAFT_209241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 18912822
NCBI-ProteinID: XP_007396040
JGI: Phaca1_209241
UniProt: K5UZV4
LinkDB All DBs
Position
Unknown
AA seq 684 aa AA seqDB search
MSGFVPQPIDDVAIATIRTLAADVVGKANSGHPGAPMGMAPAAHVLFTRFFNTNPKNSKW
YNRDRFVLSNGHACALQYILLHLLGFKLSLDDLKAFRQLDSLTPGHPEAGHTDGIEVTTG
PLGQGFANAVGLGIAQAHMAAIFNKPGFDLINNYTYVFTGDGCLMEGVSSEAASLAGHLQ
LGNLIYIYDDNHISIDGDTAVAFTENVEQRFLSYGWQVLHVDNGDSDLEAIYNAIAEARK
EKNKPSLIRLRTTIGFGSKQQGTHGVHGSPLKADDIAALKSKSGFPADQTFYIPQDTYDA
YHAAALKGAKLEQEWNGLLGAYAQQYPKEHAELTRRIAGELPKDWEKSLPVYKATDAAQA
SRKLSEIVLTAISPVLPDLIGGSADLTGSNLTRVKQAVDFQPPSTGLGNYAGTYIRYGVR
EHAMGAIANGLAAFGGIIPFIGTFLNFVSYAAGAVRLSALSHHQVIWVATHDSIGLGEDG
PTHQPVETVAHFRAMPNIDVWRPADGNETSAAYYSALTRKNNPSILCLSRQNLPNLEAST
IEHALKGGYVVHEIEGEDLTFVSTGSEVSIVLEAAKKLEAEGVKARVVSLPCWERFDSQP
EEYRLSVLRSGAPILAVEAYNTFGWHKYSHEQFGLVGWGASGPYKKVYEKFGLTGDNISI
VGKKIVDFYRKKGGEVVSPLVKAL
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttttgttccccagcccatagacgacgtcgctattgccaccatccgtaccctc
gctgcggatgtcgttggaaaggctaactcgggtcaccctggtgcccccatggggatggcc
ccagcggctcatgtcctcttcactcgcttcttcaataccaaccccaaaaattcaaagtgg
tacaatcgcgatcgatttgtcctctctaatgggcatgcatgcgctctgcagtacatcctc
cttcacctccttggtttcaaactatctctcgatgacttgaaggctttccgtcagctcgac
tctttgacccctgggcacccagaagctggtcatactgatggcattgaggtcactaccgga
ccccttggccagggctttgcaaacgcggtcggcctcggcatcgctcaggcgcacatggct
gccatcttcaataagccaggttttgacctaatcaataactacacttatgtcttcaccggt
gatggctgtctcatggagggtgtttcttcggaggcggcgagtttggctggtcacctccag
ttgggcaatctcatctacatctatgacgacaaccatatctctattgacggtgataccgcg
gttgcatttaccgagaacgtagaacagcgcttcctttcctacggatggcaggtcctgcac
gtcgacaacggtgatagtgaccttgaggctatctacaacgctatcgccgaagctcgcaag
gagaagaacaagccatcgcttatccgtcttcgtaccaccatcggttttggctccaagcag
cagggtacccacggtgttcatggttctccccttaaggctgacgatattgctgccttgaag
tcgaagtccggcttccctgcagaccagaccttctatatcccccaggacacctacgatgcc
tatcacgctgccgccctcaagggtgccaagcttgagcaagagtggaatggtctcctcgga
gcatacgctcagcagtaccccaaggagcacgcagagctcactcgccgtattgcgggcgag
ctccccaaggactgggagaagagtctgcctgtttacaaggccaccgatgctgcccaagct
tcgcgcaagctgtctgagatcgtcctcactgccatctcccctgtccttccagacctcatc
ggtggctctgcggacttgactggcagcaacttgacccgcgtcaagcaggctgttgacttc
cagccaccaagcactggtctaggcaactacgccggcacatacatccgttatggtgttcgt
gagcatgccatgggcgccatcgctaatggtctggctgctttcggtggcattatccccttc
atcggtaccttcttgaatttcgtctcatatgccgctggtgctgttcgcctctctgccctg
agtcatcaccaagtcatttgggtcgctacccacgattccatcggtctcggtgaagatggg
ccgacccaccagcctgttgaaactgttgcccacttccgtgcgatgccgaacatcgacgtc
tggaggccggctgacggtaacgagacgtctgcggcatactacagcgcgctcacacgcaag
aacaacccctcgatcctctgcttgtcgcgtcagaacctcccgaaccttgaggcgtcgacc
attgaacatgcgctgaagggcggctatgtcgtccatgagatcgagggcgaggatctcacc
ttcgtctccaccggtagcgaggtcagcatcgtcctcgaggctgcgaagaagctcgaggcc
gagggcgtgaaggctcgtgttgtctcccttccatgctgggagcgtttcgacagccagccg
gaggagtaccgcctcagcgtactccgcagcggtgctcccattctcgctgttgaagcctac
aacacttttggctggcacaagtactctcatgagcagttcggcctcgtcggctggggcgct
tccgggccatacaagaaggtttacgagaagttcggcctcacgggagacaacatctctatc
gtcggcaagaagattgtcgacttctacaggaagaaggggggagaagtcgtctcaccctta
gtcaaggctctgtag

DBGET integrated database retrieval system