KEGG   Phanerochaete carnosa: PHACADRAFT_246104Help
Entry
PHACADRAFT_246104 CDS       T03128                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pco  Phanerochaete carnosa
Pathway
pco00052  Galactose metabolism
pco00500  Starch and sucrose metabolism
pco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PHACADRAFT_246104
   00500 Starch and sucrose metabolism
    PHACADRAFT_246104
Enzymes [BR:pco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PHACADRAFT_246104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18913726
NCBI-ProteinID: XP_007389717
JGI: Phaca1_246104
UniProt: K5WLD7
LinkDB All DBs
Position
Unknown
AA seq 973 aa AA seqDB search
MQPTVLLAFLLSAGIAAAREPSRLQQRVLPQTDAAAASGFSGNISACPGYTLQNLAETAT
GLTADLALAGPACNAFGHDLANLTLEVTYDSETRLHVNVYDTARSQFTVPSSVIALPPAP
TSSNKNSSDLVFNYESSPFAFWITRRSSPADAPLFDTRISSLPPTPIPPLNASDQSTALD
GFPLVFEDSYLQLASALPKGTNIYGLGEVVASSGFRRDVGDNGGFGTLQTFWNRDKQDPL
DQNVYGSHPIYLEHRFDEQTNTSKSHGVFLFSAAPADIFLVTPASSNVSLIEYRLVGGIL
DMYFFSGPTSQKVVEQYTDVIGKPTWQPAWGLGFHLCRWGFKNISETMDAVKGMKDANVP
LEVMWNDIDLYHAFRDFTADPVSFPPDEMRTFIQELAQNNQHYIPIVDAAIAHQGNASDL
YAPYLRGAELDAFVKNPDGSEYIGQVWPGYTVFPDWFGPNTQQLWTEALSNWSALGIEFS
GIWLDMNEISSFCNGSCGTGQDWSNTTLSFLLPGDPGMEITDWPEGYNSTISGTSGNITV
NGTLTYGAGADIDPSQGLIGKRGLGSAQDHMNLSDPPYAVHNGNGPLYVSTLATNATHAG
GYVELDTHNLWGMMESHATHAALSSIHPGKRPFIIARSTFPSSGKWTGHWLGDNYSKWAY
MRASLPGVLQFQLFGIPMVGADVCGFQGNTDEELCSRWMMLGAFLPFFRNHNQRGALSQE
PFRWDSVANASRTAIGIRYSLLPYWYTLFANSSQHGTPTVRALFFEFPDEPELFALDTQF
MVGRDLLVTPVLTPNVSTVDGIFPGRGRTIWRDWYTHEVVNASVGANTTLSAPLGHIPVH
IRDGSAILLHAKTGYTIAETRTSPYALLISQASDGYAFGSAYMDDGESLPPTPNRSVQFH
AIRGELKIENSGTYEVEPKLESVTVLGTQKPTAVSVSGTMLPAESWTYDESKMELVVNEL
EVDLNEATTIQWQ
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccactgtgctcctcgcatttttgctttctgcaggtattgctgctgcgcgagag
ccatcccgactgcagcaacgagttttgcctcaaactgacgccgctgccgccagcggattc
tctggcaacatctctgcatgcccaggctacactctgcaaaatctggcagagactgctact
ggtctcacggccgacttagcgctcgctggtcctgcgtgtaatgcttttggacacgatctc
gctaatttgacccttgaagtcacttatgactctgagactcggctgcacgtcaatgtttac
gacaccgcgcggtcacagttcaccgtgccttcgtctgtcatcgcgcttccaccagcaccg
actagctcgaacaagaatagctcagacctcgtgttcaactacgaatcttcgccatttgca
ttctggattactcgccgctcttcccccgcggacgcgcctttgttcgacactcgtatctcg
tcgctgcctccgacgcctatcccgcctctgaacgcttccgaccagtcgactgcgctcgac
gggttcccgttggtatttgaagattcgtacctacagctcgcgtctgcgcttccgaagggc
acaaatatctacggtttaggcgaggttgttgcaagcagcggcttccgacgcgatgtaggc
gacaatggtggatttggcactctccagacgttctggaacagagataaacaagatccgcta
gaccagaatgtgtatggttcgcatcccatttacctggagcaccgcttcgatgaacagacg
aacacgtccaagtctcatggcgtctttctcttcagcgcggcgcccgcggatatcttcctc
gtcacaccggcctcttcaaacgtctcgctcatcgaataccgtctcgttggtggaattctt
gacatgtacttcttctcgggtcccacgtcacagaaggtcgtcgagcagtacacggacgtg
attggcaagccgacatggcagcctgcttggggccttggtttccacctctgtcggtggggg
ttcaagaacatcagcgaaacaatggacgctgtcaagggtatgaaggatgcaaatgtcccg
ctcgaagtaatgtggaacgacatcgacctgtaccacgcattcagggacttcactgcagat
cccgtatcgttcccgcccgatgagatgcggacattcatccaagagctggcccaaaataat
cagcactacatcccaatcgttgacgctgccatcgcacaccaaggaaatgcaagcgatctc
tacgctccgtaccttcgcggtgccgaactagatgccttcgtcaagaacccggatggctca
gagtacatcggccaggtctggccaggatacaccgtcttccccgactggttcggtcccaac
acccagcagctctggaccgaggcactttcaaactggagtgcactgggtatcgaattcagc
ggcatctggcttgatatgaacgagatctcgagtttctgcaacggcagttgtggaaccgga
caggactggagtaacactacgctgtcgtttctacttcctggcgaccccggaatggagatc
acggattggccggaaggatataactcaactatctctggcacgagtggaaacatcactgtc
aacggcacgttgacgtacggtgctggggccgacatcgatcctagtcaagggctgatcgga
aagcgaggcctcggctctgcacaagaccatatgaacctcagcgatccgccatacgccgtc
cacaatggaaacggtcctttgtacgtcagcacgcttgccactaatgcgacgcacgctgga
gggtacgtcgagctcgacacgcacaacctttgggggatgatggagtctcatgcaacccac
gccgcgctctcctcgatccatccggggaagcgccccttcatcattgcgcggagcaccttc
ccgtcgtcgggcaagtggactgggcactggctcggtgacaactacagcaagtgggcgtac
atgcgcgcgagtcttcccggcgtgcttcagttccagctgttcggcatcccaatggttggt
gcggacgtgtgcggcttccaagggaacacggacgaggagctctgcagccgctggatgatg
ctcggcgcgttcctgccgttcttcaggaaccacaaccagagaggtgccctcagccaggaa
ccgttccggtgggatagcgtggcaaatgccagtcggaccgccattgggatcaggtactca
cttctgccgtattggtacactttgttcgcgaattcgtcgcagcatggcaccccgaccgtg
agggcactattcttcgagttcccagacgagcccgagctgttcgccttggacacccagttc
atggtcggacgtgatctgctcgtcacgcccgtgctcacgccgaacgtttctacggtagat
ggtatattcccaggccgaggccgtaccatctggcgcgactggtacacccacgaagttgtc
aatgccagcgtcggtgccaatacgactctgtccgcgccgctcggccacatccccgtgcac
atccgcgacggctccgcgattctccttcacgcaaagaccggatacaccattgccgagacc
cgcacgtccccctacgccctgctcatatcgcaggcctcagacggatacgccttcgggtcg
gcgtacatggacgacggcgagagcctgccgccgacgccgaaccgctctgtccagttccac
gccattcgcggcgagctcaagatcgagaactcggggacgtacgaggtggagcccaagctg
gagagtgtaacggtgctggggacgcagaagcctactgcggtctcagtgagtggtacgatg
ctgcctgcggagagctggacgtacgacgagtctaagatggagctcgttgttaacgaactg
gaagtcgatctgaacgaggctactacgatccagtggcagtaa

DBGET integrated database retrieval system