KEGG   Phanerochaete carnosa: PHACADRAFT_254949Help
Entry
PHACADRAFT_254949 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pco  Phanerochaete carnosa
Pathway
pco00020  Citrate cycle (TCA cycle)
pco00480  Glutathione metabolism
pco01100  Metabolic pathways
pco01110  Biosynthesis of secondary metabolites
pco01130  Biosynthesis of antibiotics
pco01200  Carbon metabolism
pco01210  2-Oxocarboxylic acid metabolism
pco01230  Biosynthesis of amino acids
pco04146  Peroxisome
Module
pco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pco_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHACADRAFT_254949
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PHACADRAFT_254949
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PHACADRAFT_254949
Enzymes [BR:pco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PHACADRAFT_254949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 18916178
NCBI-ProteinID: XP_007395085
JGI: Phaca1_254949
UniProt: K5WDZ5
LinkDB All DBs
Position
Unknown
AA seq 449 aa AA seqDB search
MLGLRTLRSGRLAKPSAIRSSLMARGFANSVPRYQEKIMVKNPVVELDGDEMTRIIWKKI
REELILPYLQLDIKYYDLGIEARDATSDKVTVDSAEAILKYGVGIKCATITPDEERVKEF
KLKEMWRSPNGTIRNILGGTVFREPIILQRIPRPIPGWKNPIVIGRHAFGDQYRSTDFVA
PGPGRIQLVYTPENGGEPVAMTVYDFKGKGVAMAMYNTDESIKGFAHSSFKMALSKKLPL
FMSTKNTIMKKYDGRFKDIFQEIYESEYQKAFEEAGIYYEHRLIDDMVAQAIKSSGGFVW
ACKNYDGDVQSDILAQGFGSLGMMTSELITPDGKTVESEAAHGTVTRHYREWQKGRETST
NPVASIFAWTRGLIHRAKLDGNDALKHFCEDLEAACVEVIDTDGVMTKDLALAIHGKNMK
REHWVITDVYMDAVNAKLKEKMKARKSKA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtctgcgcacacttcgtagcggtcgcctggcaaagccatctgccattcgcagt
agcctgatggctcgcggctttgcgaacagtgtgccgcggtatcaggagaaaatcatggtc
aagaaccccgtcgtggaactagatggcgatgagatgactaggattatctggaagaagata
agggaggagcttatcctcccatatcttcaactggacatcaagtactatgacctcggtatt
gaagcccgagacgctaccagcgacaaggtaaccgtcgactctgccgaagcgatcctcaag
tatggtgttggcattaagtgcgcgactatcacacccgacgaggaacgtgtgaaggagttc
aagcttaaggagatgtggaggagcccgaatggcacaattcgtaacatccttggaggcact
gtcttccgtgagcccatcatactccagcgtattccaaggccaattccaggatggaagaac
cccatcgttatcggccgtcacgcatttggtgaccagtaccgctcgaccgacttcgtcgcg
ccaggaccgggaaggattcaactggtttatacgcctgaaaacggtggtgagcccgtggca
atgaccgtctacgacttcaagggcaagggtgttgccatggccatgtacaataccgatgag
tcaataaagggattcgcccactcttcgttcaagatggccctttccaagaagttgccactg
ttcatgtccacgaagaacacgattatgaagaagtacgacggccgcttcaaggacatcttc
caggagatctacgagagcgaataccagaaggcattcgaggaggccggcatctactacgag
caccgtctcattgacgacatggtcgcacaagcgatcaagtcgtctggcggtttcgtctgg
gcgtgcaagaactacgacggtgacgtccagtctgacatcctcgcccaaggcttcggctct
cttggtatgatgacctcagagcttatcacgcccgacggcaagactgtcgagagcgaggct
gcgcacggcactgtcacccgtcactaccgcgagtggcagaagggtcgcgagacctcgacg
aaccctgtcgcgtccatctttgcctggacgcgcggactcattcaccgtgctaaacttgac
ggaaatgacgcgctcaagcacttctgcgaggacctcgaggcggcgtgtgttgaagtcatc
gataccgacggcgtcatgaccaaggaccttgccctcgctatccacggaaagaacatgaag
cgcgaacactgggtcatcactgacgtttatatggatgctgttaatgctaagctcaaggag
aagatgaaggcccgcaagtcgaaggcctaa

DBGET integrated database retrieval system