KEGG   Phanerochaete carnosa: PHACADRAFT_256884Help
Entry
PHACADRAFT_256884 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pco  Phanerochaete carnosa
Pathway
pco00020  Citrate cycle (TCA cycle)
pco00190  Oxidative phosphorylation
pco01100  Metabolic pathways
pco01110  Biosynthesis of secondary metabolites
pco01130  Biosynthesis of antibiotics
pco01200  Carbon metabolism
Module
pco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pco_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHACADRAFT_256884
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PHACADRAFT_256884
Enzymes [BR:pco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PHACADRAFT_256884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO Lycopene_cycl HI0933_like TAL_FSA
Motif
Other DBs
NCBI-GeneID: 18916686
NCBI-ProteinID: XP_007396243
JGI: Phaca1_256884
UniProt: K5V0E9
LinkDB All DBs
Position
Unknown
AA seq 639 aa AA seqDB search
MLRKQLRKAVVGAQRSFSSSAPARKVVATNPVKAQEVQSWDSGKYPLIEHEYDAIVVGAG
GAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
DWLGDQDAIHYMCREAPSTVIELEHFGVPFSRTKEGKIYQRAFGGQSLKFGKGGQAYRCA
AAADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRAH
KTVLATGGYGRTYFSCTSAHTCSGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEG
SRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGIGPEKDHLYLQLSH
LPPEILHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTRYTGEVVTTDENGKD
KVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIKETLTPGKPHKKISDEAG
LQSVEYLDKIRNADGPNPTAKIRLDMQKAMQADAAVFRTQESLDEGVQKIGQIYKSYDQV
GIKDRSMIWNSDLVETLELRNLLQCAVQTITAAAARKESRGAHAREDFPERDDENWMKHT
LTWQHDPSTPDVDIKYRGVIDKTLDENECKAVPPFKRVY
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaagcaactacgaaaggccgttgttggcgcgcagaggtctttctccagctct
gcgcctgctcgcaaggtcgtcgcgaccaacccggtgaaagcgcaggaagtacaatcatgg
gattcaggaaaatatcctctcattgaacatgaatacgatgctatcgttgtcggtgccgga
ggtgcaggtctgcgagcagcattcggtctcgcggaggccggcttcaataccgcttgtatc
accaaactcttccccacgcggtctcataccgtcgctgcccagggtggtattaatgcggct
ctcggaaacatgactgaggacgactggaggtggcacatgtacgatactgtcaaagggtca
gactggttgggtgaccaggatgccatccactatatgtgtcgtgaagctcctagcactgtt
atcgagcttgagcacttcggtgtaccattctcgcgaacgaaggaaggcaaaatctaccaa
cgggccttcggtggtcaatcgttgaagttcggcaaaggtggccaggcgtaccgttgcgct
gccgctgctgaccgtaccggtcacgctcttctccacactctgtacggccagtccctccgt
cacaacaccaacttcttcatcgaatacttcgcccttgacctgatcatgcaagatggcgag
tgtgtcggtgtcattgccctgaacatggaggatggcaccctccaccgcttccgtgcgcac
aagacggttttagcgactggtggttacggacgtacctacttcagctgcacgagtgcacac
acatgttctggtgatggtaacgctatggttgctcgtgctggccttcctctgcaagatctt
gagttcgtacagttccacccaaccggtatctatggtgctggctgtctcattaccgaaggt
tctcgtggggaaggaggctatcttctcaactctgagggtgaacgtttcatggagcgttac
gcccccaccgcgaaggatcttgcttctcgtgatgtcgtctcccgtagtatgacaattgag
atccgcgaaggtcgtggtattggtccggagaaggaccacctctacctgcaactcagccat
ctaccgccagagattctccacgagcggctccctggtatctctgagacggctgccatcttc
tccggtgttgatgtcaccaaggagcccattcccgttctgccgactgtgcactacaacatg
ggtggtattcctacccgctacactggtgaagtcgtcaccactgacgagaacggcaaagac
aaagtcgttcccggtctttacgccgctggtgaggctgcatgtgtatctgtccacggtgcg
aaccgcctcggcgccaactcgctcctcgacatcgtcgtcttcggtcgtgcttgcgctcac
cacatcaaggaaaccttgactcctggcaaaccccacaagaagatctccgacgaggctggt
ctccaaagcgtcgagtacctcgataagatcaggaacgccgatggccctaatcctactgct
aagatccgtcttgacatgcagaaggctatgcaggctgatgctgctgtcttccgtactcag
gagtccttggacgagggtgttcaaaagatcggccagatctacaagagttacgaccaagtt
ggcatcaaggacaggagcatgatctggaactccgaccttgttgagactcttgagctccgc
aacctccttcagtgcgccgttcagactatcactgccgctgccgcccgcaaggagtcccgt
ggtgcccacgcccgtgaggacttccctgagcgtgacgacgagaactggatgaagcatacg
ctcacctggcagcacgacccctcgacacccgacgtcgacatcaagtaccgtggcgttatc
gacaaaacgctcgacgagaacgagtgcaaggctgttccgccgttcaagcgtgtctactaa

DBGET integrated database retrieval system