KEGG   Phanerochaete carnosa: PHACADRAFT_259591Help
Entry
PHACADRAFT_259591 CDS       T03128                                 

Definition
(RefSeq) glycoside hydrolase family 13 protein
Organism
pco  Phanerochaete carnosa
SSDB OrthologParalogGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 18917463
NCBI-ProteinID: XP_007398011
JGI: Phaca1_259591
UniProt: K5W345
LinkDB All DBs
Position
Unknown
AA seq 577 aa AA seqDB search
MARSSLACLLISLLTFVAGSTSSPAQFPVQAPEALKNVIVQMFEWTWDSVAAECYNFIGP
AGYGFVQVSPAQEHVQGSQWWTDYQPVSYTLTSKRGDRDQYTNMINTCHAAGVGVIADTL
LNHMSGSDDGGVGVGGSSFQHYVYPGIYEYQDFHHCGLEPDDNIVDYSNAVEVQTCQLDN
LADLFTESEYVRSRLAAYVNDLLSLGVDGLRLDAAKHINANDIANITSRLRRAPYITQEV
IFGTGEPITPIQYVNIGDVQEFRYTTAVQNAFSGSGISGLQSFDNLGWVPGTSANVFVSN
HDTERNGNSLNANSPSNIYVTAMVFSLAHPYGMPTILSSYSDFTDYDAGAPNGGAGTCTT
GGGTNGWLCQHRWNAIAGMVGFHNQVGTAAMNNWVSPQSEQIAFGRGSLGFVAINNADAV
WTTTFATSLPDGTYCDVISGISSSGVCTGTAFTVSDGKFTAGVQARNAIAIHSGATGTAG
ATITVNFAENANTTWGENIFLVGSVPQLGSWSPNSALPLSPASYPTWTVSVSLPPNTAFE
YKFIRKETNGTVVWESDPNRSATTPGSGSLDLTESWR
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcagcagcctcgcgtgtttgctcatcagcctgctgacctttgtcgctggcagc
acatcctccccggcgcagttccccgtgcaagcacccgaagccctcaaaaatgtcatcgtc
cagatgtttgaatggacgtgggacagcgttgcggcggaatgctataacttcatcgggcct
gccgggtacggcttcgtgcaagtcagccctgcccaggaacatgtccaaggttcgcaatgg
tggacggattaccagcccgtatcatacactctcacctcaaagcgcggagacagagaccag
tacactaacatgattaatacttgccatgccgctggtgtcggggttattgcagacactctc
ctcaatcacatgagtggttcagacgacggcggcgtcggcgtcggggggtcgtcattccag
cattatgtctatcctggaatatacgaataccaagacttccatcactgcggcctagagccc
gacgataatatcgtcgactatagtaatgctgtcgaagtccagacttgccaactggacaac
ctggcagacctattcacggagtcagagtatgtgcggagccgactggcggcgtatgtgaac
gacttgctttcgttgggcgtcgacgggctgcgactggatgcggcaaagcatatcaatgcg
aacgacattgccaacatcacttctcgcttacgccgggctccgtacatcacgcaagaagtt
atcttcgggacgggcgaacctataacccccatccaatatgtcaacatcggcgatgtacaa
gagttccgctacactaccgcagtacaaaacgccttttcgggcagtggcatctccggcctg
cagagcttcgataaccttggatgggtacccggaacatcggccaatgtcttcgtttcaaac
catgatacagagaggaatggcaactcgttgaacgccaactcgccttcaaatatctatgtc
actgccatggtcttttccctcgcacatccatatgggatgccgaccattctctcgagctac
agtgacttcacggactacgatgccggggctccgaatggcggagcgggtacgtgcaccacg
ggtggtgggaccaatggctggctatgccagcaccgatggaacgccatcgcaggcatggtc
ggcttccacaaccaagttggcaccgcggccatgaacaactgggtgtcgccgcagtcggag
cagattgcgttcgggcgaggctctctcggttttgtcgcgatcaataacgcagacgccgtc
tggaccacgaccttcgccacttctctgccggatgggacgtattgcgacgtcatcagtggt
atcagctcgtccggagtatgcacagggactgcgttcactgtttctgacggaaagttcacg
gctggcgtgcaagctcgcaacgctattgccattcacagtggcgcaacgggcaccgcaggt
gctacgatcacggtgaactttgcagagaatgccaatacgacgtggggcgagaatattttc
ttggtgggcagtgttcctcagctgggctcgtggagccccaactctgcgctccctctatca
cccgccagctaccccacgtggaccgtctcggtgtctctgcctccgaacacagccttcgag
tacaagttcatcaggaaggagacgaacggaactgttgtctgggaatccgaccctaatcgc
tctgcaacgactccgggctcggggtcactggatttgactgagagctggagatag

DBGET integrated database retrieval system