KEGG   Phanerochaete carnosa: PHACADRAFT_259610Help
Entry
PHACADRAFT_259610 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pco  Phanerochaete carnosa
Pathway
pco00020  Citrate cycle (TCA cycle)
pco00190  Oxidative phosphorylation
pco01100  Metabolic pathways
pco01110  Biosynthesis of secondary metabolites
pco01130  Biosynthesis of antibiotics
pco01200  Carbon metabolism
Module
pco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pco_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHACADRAFT_259610
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PHACADRAFT_259610
Enzymes [BR:pco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PHACADRAFT_259610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 18917470
NCBI-ProteinID: XP_007398019
JGI: Phaca1_259610
UniProt: K5WSH2
LinkDB All DBs
Position
Unknown
AA seq 274 aa AA seqDB search
MQSLIARSAFVRSQAARVPVVRTFASSAARFQATPAEKPVLQKEFKIYRWNPDQPAEKPT
LQSYTIDLNQCGPMILDALIKIKNEIDPTLTFRRSCREGICGSCAMNINGQNTLACLCRI
ERDSGKDSKIYPLPHMYIVKDLVPDLTLFYKQYKSIEPYLKNDNPPQGREFLQSQEDRRK
LDGMYECILCACCSTSCPSYWWNQDVYLGPATLMAAYRWIADSRDTYKAERKEKLQNEMS
LYRCHTIFNCARTCPKGLNPAQAIAKLKLELAAE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccctcatcgcccgctccgccttcgtgcgtagccaggcagcccgcgtgcctgtc
gtgcgcaccttcgcctcgtccgctgcacgcttccaggcgaccccggcagagaaacctgtc
ctgcagaaggagttcaagatctaccgctggaacccagatcagccagcggagaagccgacg
ctgcaatcgtacactattgacctcaaccagtgtggtcctatgattctcgatgcgctcatc
aaaatcaagaacgagatagaccctacccttaccttccgtcggtcatgtcgcgaaggcatc
tgcggttcttgtgccatgaacatcaacggccaaaatacccttgcgtgtctttgcagaatt
gaacgcgactccggcaaggattccaagatttatccccttcctcacatgtacatcgtcaag
gacctcgttcccgacctgacactcttctacaaacagtacaagtctatcgaaccctacctc
aagaacgacaacccaccgcagggtcgtgagttcctgcagtcacaagaggaccgcaggaag
ctggacggcatgtatgaatgcattctctgcgcctgctgctcgacatcctgcccgtcgtac
tggtggaaccaagacgtctacctcggcccggcgacgctcatggctgcctaccgctggatc
gccgactcgcgcgacacctacaaggccgagcgcaaggagaagctccagaacgagatgagc
ctgtaccggtgccacacgatcttcaactgtgcccggacgtgcccgaagggtctcaacccg
gcgcaagcaattgccaagctcaagcttgagcttgccgccgagtaa

DBGET integrated database retrieval system