KEGG   Phanerochaete carnosa: PHACADRAFT_259750Help
Entry
PHACADRAFT_259750 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pco  Phanerochaete carnosa
Pathway
pco00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PHACADRAFT_259750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pco02000]
    PHACADRAFT_259750
Enzymes [BR:pco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PHACADRAFT_259750
Transporters [BR:pco02000]
 Other Transporters
  Pores ion channels [TC:1]
   PHACADRAFT_259750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 18917515
NCBI-ProteinID: XP_007398088
JGI: Phaca1_259750
UniProt: K5UTW0
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MSIPDERIFPHATGTAAKTVEKRQEPQDLVFYSGWFCPFVQRAWIALEERGIPYQYKEVN
PYKKERHFLDINPKGLVPAVEYKGKALYESLVLCEFLEDAYPTYKPNLLPSDPFERNYAR
IWLDYISKSIVPAFFRLIQAQTSEKRQEALAEWNKALTQFAEKIKGPYFLGEEFSLVDVA
IVPWIVRDYIVAENRGFKRDDVGSKWIEYAARLEKRDSVSKTSSDKEHYAEIYGRYLRDE
AQSEAAKATRAGRAIP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcccgacgaaaggatctttcctcatgcgaccggcacggcagccaagacggtt
gagaagcgtcaggagccgcaggacctcgtgttctactctggttggttctgcccgttcgtg
cagagggcttggattgcccttgaagagcgcgggattccataccagtacaaagaggtgaac
ccgtataagaaggaaaggcacttcctcgatattaaccccaaaggccttgtccccgctgtc
gagtataagggtaaagctttatacgagtcgctcgtcctctgtgagttcctcgaggatgcg
taccctacgtataagcccaatctcctcccgtctgatccattcgagcggaattatgcacgc
atctggctcgactacatctccaaatctattgtccctgcctttttccgcctcattcaggcg
cagacgtccgagaagcggcaggaggccctcgcagaatggaacaaggccctaacgcagttc
gcggagaagatcaaggggccgtatttcctcggcgaggaatttagcctcgtcgatgtcgcc
attgtgccgtggatcgtcagggattacatcgtcgctgagaacagagggttcaagcgcgac
gacgtcggaagtaagtggatcgagtacgcggcgaggctggagaagagggacagcgtcagc
aagaccagtagtgataaagagcactatgctgagatatatggtcgatatctccgcgacgaa
gctcaaagcgaagccgccaaagctacccgagcaggccgtgcgatcccttga

DBGET integrated database retrieval system