KEGG   Phanerochaete carnosa: PHACADRAFT_261990Help
Entry
PHACADRAFT_261990 CDS       T03128                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pco  Phanerochaete carnosa
Pathway
pco00500  Starch and sucrose metabolism
pco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PHACADRAFT_261990
Enzymes [BR:pco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PHACADRAFT_261990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18918152
NCBI-ProteinID: XP_007399504
JGI: Phaca1_261990
UniProt: K5WMZ0
LinkDB All DBs
Position
Unknown
AA seq 573 aa AA seqDB search
MRFLVLTSLASLLTSVLGQSSSVDSYVASESPIAKAGLLANIGPSGAKSSGAKAGVVIAS
PSTTNPDYLYTWVRDSSLVFKTIIDQYTSGQDTSTRSLIDEFVSAEATLQQVTNPSGSVT
TGGLGEPKFNIDETAFTGAWGRPQRDGPALRSTAIINYANWLIANDNSSWVTNNLWPIIK
LDLDYVANNWNQSTYDLWEEVDSSSFFTTAVQHRALREGSTLATKIGQTSVVSGYNTQAD
NLLCFLESYWNPSGAYITANTGGGRSGKDANTVLASIHTFDPAAGCDATTFQPCSDKALS
NLKVYVDSFRSIYGVNSDIASNAAVATGRYPEDVYYNGNPWYLATFAVAEQLYDSLIVWN
AQGSLTVTSTSLPFFQQFLSSVTAGTYASSTSTFQTLITDIKTFADGFVAMNDKCTPSGG
GLSEQYDKNTGSPISAADLTWSYASALTAFAARSGFASPGWGAQGLSVPATCSGSSGPTV
AVTFNVQATTVLGENIYITGSVDALENWSPTSALLLSSANYPTWSITVNLPANTVIQYKY
IRNNDGSITWESDPNNQITTPASGSFTVNDTWR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcctggtgctcactagcctcgcgtcgctgctgacgtccgtcctcggacagtca
agtagcgtcgactcgtatgtcgcgtcggagtcgcccatcgcgaaggcgggcctccttgcg
aacatcggacccagcggcgccaagtcgagcggtgcgaaggcgggcgtagtcattgcgagt
ccaagcacgaccaacccggactacctctatacctgggtccgcgactcgtctctcgtattc
aagaccatcatcgaccagtacacctccggccaggacacgtccacgcgcagcctcatcgac
gagttcgtctcggcagaggcgacactgcagcaagtcaccaaccccagtggcagcgtgacc
actggcgggttgggcgagcccaaattcaacatcgacgagactgctttcactggtgcatgg
ggtcgtccgcagagagatgggcccgctctgcgttcgactgcgatcatcaactatgcgaac
tggctcattgccaacgataactcttcttgggtaaccaacaatctctggcccatcatcaag
cttgacctcgactacgtcgcgaacaactggaaccagtctacatatgatttgtgggaagag
gtggactcgtcttctttcttcacgactgcagttcagcaccgcgctttgcgcgaaggctcc
actctggccacgaagatcggccagacctccgttgtcagcggatacaacacccaggctgac
aaccttctctgcttcttggagtcatattggaaccctagcggggcctacatcacagctaac
actggcggcggccgttctggcaaggatgcgaacacggtgcttgcctccatccacactttc
gaccctgccgctggatgtgatgcgaccaccttccagccatgttcggacaaggcgctttcg
aacctgaaggtctatgtcgattctttccgctctatctatggtgtcaacagcgacatcgca
tccaacgccgctgtcgcaactggccgctaccccgaggacgtctactacaacggcaacccc
tggtacctcgcgacattcgccgtggcggagcagctgtacgactccctcatcgtgtggaat
gcgcagggctccctgacagtcacgagcacgtccttgccattcttccagcagttcttgagc
agcgtgactgcgggcacgtacgcctcgtcgacatccaccttccagacgctcattaccgac
attaagaccttcgcggatggctttgtcgcgatgaacgacaagtgcacgccatctggcgga
gggctctcggagcaatacgacaagaatactggcagcccaatcagcgcagccgacctcacc
tggagttatgcttctgccctcacggctttcgccgctcgcagcggcttcgcgtctcccgga
tggggcgcccaagggctgtctgtccccgccacctgttcagggagctccggtcccactgtg
gcagtgaccttcaatgttcaggccacgactgtattgggagagaacatctacatcactggt
tccgtcgacgcgcttgagaactggtcgccgaccagcgcccttcttctttcgtctgctaac
tatccgacctggagcatcactgtcaatcttcccgcgaacaccgttatacaatacaagtac
atccggaataacgacggctctatcacctgggagtccgacccaaacaaccaaatcacaact
cccgccagcggtagcttcaccgtcaacgacacctggcggtga

DBGET integrated database retrieval system