KEGG   Phanerochaete carnosa: PHACADRAFT_93074Help
Entry
PHACADRAFT_93074  CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pco  Phanerochaete carnosa
Pathway
pco00562  Inositol phosphate metabolism
pco01100  Metabolic pathways
pco04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PHACADRAFT_93074
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    PHACADRAFT_93074
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pco01009]
    PHACADRAFT_93074
Enzymes [BR:pco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PHACADRAFT_93074
    3.1.3.48  protein-tyrosine-phosphatase
     PHACADRAFT_93074
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     PHACADRAFT_93074
Protein phosphatases and associated proteins [BR:pco01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    PHACADRAFT_93074
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 18920816
NCBI-ProteinID: XP_007394764
JGI: Phaca1_93074
UniProt: K5WD51
LinkDB All DBs
Position
Unknown
AA seq 593 aa AA seqDB search
MTDFVRRLVSGKKARFRDEELDLELDLAYITDRIIVMGFPAAGLEGLYRNRREDAKKFLD
HRHGANYWIFNFCPIKENSYPSQVFENRVSRYPFPDHHAPPLAILPLIAREMRTWLDGSP
ERVAVLHCKGNAAGKGRSGTMACTYLLTLTDLPRPPSMGRSRAAEEKAKQRAEDFMNVMP
ADIDASVDVEPRSDASSTTSDPIKNEISNDVLDAKLTNKTTVSRVASATSLDDVLKLHTA
GRMKPPSSSSEKAKQGVSIPSQRRWLYYWSLLIAHQGPHGLWSLNESEREPPPKVHLTQI
KIRMHELSGVKANMIKAASTLMDRAGKGKLAGSTSQVWASLARYDDELVDTLEWWERTTR
VDDGNMGVRKPGSQHQPDGELTDMFATAKWDKGKMVRPFARLGTVNGDGVQKQLSEVRSL
IIAVYVLRPLSDDSWTLVKSGLEGDEQSPTVESEQDSIQDATRSLEDTSGIVLDAHREVR
VKLYIGQVFMGWFWFIPTFHMAHPRSQTQQPTVYPLTRKEIDFPLGIGSHLIDVVVSMEW
CAPDADVLSPPAREDSQDSVEGRGDPTGIGAAIHAAAIGETQQATEASQVGNE
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgacagactttgtgcgacgactcgtgtcgggaaagaaagcacgatttcgggatgaggag
ttggacttggaactagatctagcatacataacagatcggatcatagtcatgggcttccct
gcggcgggccttgaaggcctgtaccgcaaccgacgcgaggacgcgaagaagttcctggac
caccgccacggggcaaactactggatcttcaacttctgcccaatcaaagagaattcgtac
ccgtctcaagtatttgaaaatagagtcagcagatatccctttccagaccaccatgcgcct
cctctggctatcttgccgttaatcgcacgagaaatgcgcacatggctggacggatcgcct
gaacgtgtcgcggtcctgcattgcaaaggcaatgcagccggcaagggaaggtcgggcacc
atggcctgcacgtacttgcttacgctcacggatcttccccggccgccgagcatgggccgc
agccgagctgctgaagagaaggcgaaacagcgcgctgaagatttcatgaacgtcatgccc
gccgacatcgatgcttctgttgatgtagagccccgttcagacgcgtcttcaacaacgtca
gacccgattaaaaatgaaatttcgaacgatgtgctggatgcgaagcttactaataagact
acagtttccagagttgcgtcagccacttctctggacgacgttctgaaactacatactgcg
ggccgcatgaaaccgccgtcgtcgtcttccgagaaagcaaagcagggcgtaagcataccg
agccaacggcgctggctgtactactggtcactgctgatcgcacatcaaggcccgcatggc
ctctggtcgcttaacgagtccgaacgtgagcctccgccaaaggtgcacctgactcagatc
aagatccgcatgcacgagctatcgggcgtgaaggcgaacatgatcaaggcggcgagcacg
ctgatggaccgggcgggcaagggcaagctcgcggggagcacgagccaggtgtgggcgtcc
ctcgcccggtacgacgacgagctcgtggacacgcttgagtggtgggagcgcacgacacgc
gttgatgacggtaatatgggcgtgcgcaagcccggatcgcaacatcagcccgacggggag
ctcacggacatgtttgcgacggcgaagtgggacaaaggcaagatggtgcggccgttcgcc
cgcctggggaccgtcaacggagatggcgtgcagaagcagctgtcggaggtacgcagtttg
attatcgctgtctacgtcctgcgccctttatcggacgacagctggacgctggttaagtca
ggtctagagggtgatgagcagagccccacggtcgagtccgagcaggattccatacaggat
gcgacacgatcattggaggatacgagcggcattgtgctcgatgcccaccgcgaggtccgg
gtgaaactatatatcggtcaggttttcatggggtggttctggtttatacccacgttccac
atggctcacccgcgctcacaaacgcagcagcccaccgtctatccactgacgcgcaaggaa
atcgactttccgcttggtatcggatcgcacctcatcgacgtcgtggtgtcgatggagtgg
tgcgcccctgatgcggacgtcctctctccgcccgccagagaggacagccaggattccgtc
gaaggccgaggcgaccccacgggaattggggcggccatacatgctgcggcgataggggag
acgcagcaggcaacagaagcatcccaagtcgggaacgaatga

DBGET integrated database retrieval system