KEGG   Phanerochaete carnosa: PHACADRAFT_98884Help
Entry
PHACADRAFT_98884  CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pco  Phanerochaete carnosa
Pathway
pco04113  Meiosis - yeast
pco04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:pco00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    PHACADRAFT_98884
  09143 Cell growth and death
   04113 Meiosis - yeast
    PHACADRAFT_98884
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pco01001]
    PHACADRAFT_98884
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pco03019]
    PHACADRAFT_98884
   03036 Chromosome and associated proteins [BR:pco03036]
    PHACADRAFT_98884
Enzymes [BR:pco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PHACADRAFT_98884
Protein kinases [BR:pco01001]
 Serine/threonine kinases: AGC group
  PKA family
   PHACADRAFT_98884
Messenger RNA biogenesis [BR:pco03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PHACADRAFT_98884
Chromosome and associated proteins [BR:pco03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    PHACADRAFT_98884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo
Motif
Other DBs
NCBI-GeneID: 18921032
NCBI-ProteinID: XP_007398309
JGI: Phaca1_98884
UniProt: K5W3A8
LinkDB All DBs
Position
Unknown
AA seq 346 aa AA seqDB search
MDVDAQPESAVPLQVRRPTGTYRLSDFIIQRTLGTGSFGRVHLVRSKHNLRFYAIKILSK
EKIVRMKQVSHTQNEQRMLMAVQHPFIINLWGSFQDSANLYMVMDFVPGGELFTLLRRSN
RFPDPVAKFYAAEVALALNYMHGLDIIYRDLKPENILLNFDGHIKIADFGFAKHCSMNAW
TLCGTPDYLAPEIIRNERYNKSVDWYALGVLIFEMLSGLPPFHEPDASHVVLYERICQGP
LAIRWPPFDRNATDLILKFLEHDPTKRYGNLKHGAGDVFAHPWFREVDWEKLKNREITAP
YLPKIASAGDASAFERYPEDNVAATYGQPVKDEYGVMFPEFEYTSH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggatgcgcagccagaatccgccgtaccattgcaagtacgacgaccgacgggg
acgtatcggctctctgatttcatcatccaacgtaccttgggcaccggtagctttgggcgt
gtgcaccttgtgcgaagcaagcataacctccgcttctatgctatcaagatcctcagcaag
gaaaagatcgttcgtatgaagcaggtctctcacactcaaaacgagcaacgcatgctcatg
gctgtccaacacccgttcattatcaatctctggggctcattccaggactctgcaaacttg
tacatggtcatggatttcgtgccaggcggagagctgtttacgcttctcagacggtcgaac
cgcttcccggaccccgttgcgaagttctacgctgctgaggtcgcgcttgcgttgaactac
atgcacgggctcgatatcatctatcgtgacctcaagcctgagaacatcctgctaaacttc
gatgggcacattaaaattgcggacttcggcttcgcgaagcactgtagcatgaatgcatgg
acgctttgcggcaccccagactatctcgcaccggagatcattcgtaacgagcgatataac
aagtctgtcgactggtatgccctgggcgtcctcatctttgagatgctctcagggctgcca
cccttccacgagcctgacgcgagccatgtcgtgctctatgagaggatctgccagggcccc
cttgcgatccgctggccgccgttcgataggaacgcgaccgaccttatcttgaagttcctc
gagcacgatccgacgaagcgctacggcaacctcaagcacggcgctggcgacgtcttcgca
cacccatggttccgtgaggtcgactgggaaaaattaaagaacagggagatcactgcgccg
tatctccccaagattgcgagcgcgggtgacgcgtctgcgttcgaaaggtatcccgaagac
aacgttgcggcaacttacggccagccagtcaaggacgagtatggagtgatgttccccgaa
ttcgaatataccagccattga

DBGET integrated database retrieval system