KEGG   Paracoccus contaminans: B0A89_00395Help
Entry
B0A89_00395       CDS       T04876                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pcon  Paracoccus contaminans
Pathway
pcon00240  Pyrimidine metabolism
pcon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    B0A89_00395
Enzymes [BR:pcon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     B0A89_00395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK TruB_C AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ARJ70596
UniProt: A0A1W6D0H0
LinkDB All DBs
Position
88191..88763
Genome map
AA seq 190 aa AA seqDB search
MAKLYFHYSTMNAGKSTLLLQASYNYRERGMTTLLLTAAVDTRAGAGRIASRIGIAEDAV
AFGPDADLFALVQDQGAGAACIFVDEAQFLTAAQVWQLARVADDLGQPVMAYGLRSDFRG
ELFPGSAALLAIADDLREVRTICHCGRKATMVVRLDTDGQPLRQGAQIQVGGNESYVSLC
RRHWRAAMGR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgtatttccactactcgacgatgaacgccggcaagagcacgctgctgttg
caggcgtcctacaactatcgcgaacggggcatgaccacgctgctgctgaccgcggcggtg
gatacccgcgcgggggcgggccgcatcgccagccggatcggcatcgccgaggatgccgtc
gccttcggccccgatgccgacctgtttgccctcgtgcaggaccagggtgcaggggctgcc
tgcatcttcgtggacgaggcgcagttcctgaccgccgcgcaggtctggcagcttgcgcgc
gtggccgacgatctcggccagccggtcatggcctatgggctgcgcagcgattttcgcggc
gagctgtttccgggatcggccgcgctgctggcgatcgccgatgacctgcgcgaggtgcgc
accatctgccattgcggacgcaaggccacgatggtcgtgaggctggacacggacgggcag
ccgctgcgccagggcgcacagatccaggtgggtggaaacgaaagctatgtttcgctgtgc
cgccggcactggcgcgcggccatggggcgctga

DBGET integrated database retrieval system