KEGG   Paracoccus contaminans: B0A89_04190Help
Entry
B0A89_04190       CDS       T04876                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
pcon  Paracoccus contaminans
Pathway
pcon00380  Tryptophan metabolism
pcon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    B0A89_04190
Enzymes [BR:pcon01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     B0A89_04190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ARJ68949
UniProt: A0A1W6CVY8
LinkDB All DBs
Position
860421..861608
Genome map
AA seq 395 aa AA seqDB search
MTDFARTRAAFHLPQGVIYLDGNSLGPMPVAAAERVAAMMRDEWAQMLIGGWNRAGWYVQ
PRRVGDRIAPLIGAAEGQVVMGDTLSIKVFQALSAALALNPGRRVILSDSGNFPSDLYVA
QGLARVTGAELRVVAPEDVADAIGPDLAVLMLTEVDYRTGRRHDMAALTARAHEAGALAV
WDLAHSAGAVDVDLLGAGADFAVGCTYKYLNGGPGSPAFIWVHPRHAEAAQPCLQGWMGH
AAPFAFDGDYRPGAGIERMRVGTPPVIALAALDAALDVWEGVQMADLRARSVALTEAFIA
GIDASCPGVTLHSPRDPARRGSQVGLRHPQAHAVMQALIAQGVVGDFRAPDVLRFGFAPL
FNDMSDVEGAVDRLAGILRSASWDRPEYHQRAAVT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgactttgcccgcacccgcgccgcctttcacctgccgcagggggtgatctatctg
gacggcaattcgctgggcccgatgccggtggcggcggccgagcgcgtggcggcgatgatg
cgggacgaatgggcgcagatgctgatcggcggctggaacagggccggctggtatgtccag
ccgcgccgcgtcggcgaccgcatcgcgcccctgatcggcgcggccgaggggcaggtcgtc
atgggcgacacgctgtcgatcaaggtgttccaggccctgtccgcggcgctggcgctcaac
cccggccgccgggtcatcctgtccgacagcggcaactttccctcggacctctatgtcgcg
caggggctggcgcgcgtcaccggggccgagctgcgcgtggtggcccccgaggatgtggcc
gatgccatcggccccgaccttgccgtgctgatgctgaccgaggttgattaccgcaccggg
cggcgtcacgacatggccgccctgaccgcgcgggcgcatgaggccggcgcgctggcggtg
tgggatctggcccattcggcgggggcggtggatgtggacctgctgggcgcgggcgccgat
ttcgcggtcggctgcacctacaaatacctgaacggcggccccggctcgcccgccttcatc
tgggtgcatccgcgccatgccgaggctgcgcagccctgcctacagggttggatgggccat
gccgcgccctttgcctttgacggcgactatcgccccggcgcggggatcgagcggatgcgc
gtcggcacgccccctgtcatcgcgctggcggcgctggacgccgcgcttgacgtgtgggag
ggcgtgcagatggccgatctgcgcgcccgttcggtcgcgctgaccgaggccttcatcgcc
ggcatcgacgcctcgtgccccggcgtcacgctgcattcgccccgcgatccggcccggcgc
ggcagccaggtcggcctgcgccatccgcaggcccatgccgtcatgcaggcgctgatcgcc
cagggcgtggtcggcgatttccgcgcgcccgacgtgctgcgcttcggctttgcgcccctg
ttcaacgacatgtccgatgtcgaaggcgcggtggaccggctggccggcatcctgcgcagc
gccagctgggatcgccccgaataccatcagcgcgccgccgtgacctga

DBGET integrated database retrieval system