KEGG   Paracoccus contaminans: B0A89_06005Help
Entry
B0A89_06005       CDS       T04876                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pcon  Paracoccus contaminans
Pathway
pcon00730  Thiamine metabolism
pcon00790  Folate biosynthesis
pcon01100  Metabolic pathways
pcon02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    B0A89_06005
   00790 Folate biosynthesis
    B0A89_06005
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B0A89_06005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcon04147]
    B0A89_06005
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pcon00537]
    B0A89_06005
Enzymes [BR:pcon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B0A89_06005
Exosome [BR:pcon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B0A89_06005
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pcon00537]
 Enzymes
  B0A89_06005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: ARJ69243
UniProt: A0A1W6CWI7
LinkDB All DBs
Position
complement(1280812..1282239)
Genome map
AA seq 475 aa AA seqDB search
MPFSHARLLATTALIACCSAGAFAQDSSAAALMDRAAKGDITVHGGARRLSGDITAAVAT
ELKSGRAKNVILLIGDGMGDSEITIARNVAEGAGGMFKGIDALPVTGQYTHYALNKDGKP
DYVTDSAASGSAWATGTKTYNGAISVDIHGKPQKTLLEMAKAAGLATGNVSTAEIQDATP
AVQAAHVAQRKCYDPTSTAEKCPDNALENGGGGSISEQHLNTRADVTLGGGRKYFDDKAR
AGDWKDKTLIEQAKERGYQVVETLDALNAVNGANDAQPLLGLFAPGNMPVRWKGPQAVHY
GNIEQPPVTCAPNPDRTAQIPTLAQMTEKAITLLSANDKGFFLQVEGASIDKQDHNANPC
GQIGETVDLDEAVQAALKFAQDKGDTLVIVTADHAHASQIVYPDTKAPGLTQAVMTKDGV
PMAISYGNADEADDQGHTGAQLRIAAYGPGAANVTGLTDQTDLFFTIRDALGLAQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcagccatgcccgccttttggcgaccactgccctgatcgcctgctgctcggcc
ggcgcctttgcgcaggacagctcggccgctgcgctgatggaccgcgcggccaagggcgac
atcaccgtgcatggcggcgcgcgccgcctgtcgggtgacatcaccgccgctgtcgcgacc
gaactgaaatccggccgtgcgaagaacgtcatcctgctgatcggcgacgggatgggcgat
tcggaaatcaccatcgcccgcaacgtcgccgagggcgcggggggcatgttcaagggcatc
gacgccctgccggttacgggccagtacacccattatgcgctgaacaaggacggcaagccc
gattacgtcaccgattcggccgcttccggctcggcatgggcaacgggcaccaagacctat
aacggcgcgatttcggtcgatatccacggcaagccgcaaaagacgctgctggagatggcc
aaggcagccggcctcgccaccggcaatgtctcgaccgccgagatccaggacgcgacgccc
gccgtgcaggccgcccatgtcgcccagcgcaagtgctatgaccccacatcgacggccgag
aaatgccccgacaacgcgctcgagaacggcggcggcggctcgatctcggaacagcacctg
aacacccgcgccgacgtgacgctgggcggcgggcgcaagtatttcgacgacaaggcccgc
gccggcgactggaaggacaagaccctgatcgagcaggcgaaggaacgcggctatcaggtc
gtcgagacgcttgatgcgctgaacgccgtcaacggcgccaatgacgcacagccgctgctg
ggcctgttcgcgcccggcaacatgcccgtccgctggaaggggccgcaggcggtccattac
ggcaatatcgaacagccccctgtgacctgcgcgcccaaccccgaccgcaccgcccagatc
ccgacgttggcgcagatgaccgaaaaggccatcaccctgctttcggcgaacgacaagggc
ttcttcctgcaggtcgagggggcctcgatcgacaagcaggaccacaacgccaacccctgc
ggccagatcggcgagacggtcgatctggacgaggccgtgcaggcggcgcttaaattcgcg
caggacaagggcgacacgctggtcatcgtgacggccgaccacgcgcatgccagccagatc
gtctatcccgacaccaaggcccccggcctgacccaggccgtcatgaccaaggacggcgtg
ccgatggcgatcagctatggcaacgccgacgaggccgacgatcagggccataccggcgcg
cagctgcgcatcgcggcctatggtccgggcgcggccaatgtcacgggcctgaccgatcag
accgacctgttcttcaccatccgcgacgcgctggggctggcgcaataa

DBGET integrated database retrieval system