KEGG   Paracoccus contaminans: B0A89_08130Help
Entry
B0A89_08130       CDS       T04876                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pcon  Paracoccus contaminans
Pathway
pcon00061  Fatty acid biosynthesis
pcon00780  Biotin metabolism
pcon01100  Metabolic pathways
pcon01130  Biosynthesis of antibiotics
pcon01212  Fatty acid metabolism
Module
pcon_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pcon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B0A89_08130
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B0A89_08130
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    B0A89_08130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pcon01004]
    B0A89_08130
Enzymes [BR:pcon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     B0A89_08130
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     B0A89_08130
Lipid biosynthesis proteins [BR:pcon01004]
 Fatty acid synthase
  Component type
   B0A89_08130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ARJ69598
UniProt: A0A1W6CXK5
LinkDB All DBs
Position
complement(1727617..1728405)
Genome map
AA seq 262 aa AA seqDB search
MTMLLQGKRALVMGVANDRSIAWGIARALAAQGAELAFSYQGEAFGKRVEPLAASLGSDV
LVDVDVTDDASLDRAFAALAERWGHLDILVHAIAFSSKDELTGRFVDTSRANFKNSLDIS
CYSLIEVARRSLPLMNAGGTILTLTYGGSNRVTPFYNVMGVAKAALESAVRYLANDLGPQ
GIRVNAISPGPMKTLAGAAIGGARKTYRHTEANAPLRANATLEAIGGTAVWLASDWGACT
TGEVVLVDGGYHVLGMPQSDNL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatgctgctgcagggcaaacgcgcgcttgtcatgggcgtggccaatgaccgctcc
atcgcctggggcatcgccagggcgctggccgcgcaaggggccgagctggccttcagctat
cagggcgaggcgttcggcaagcgcgtcgagccgctggccgcatcgcttggctcggacgtt
ctggtggacgtggacgtgaccgacgacgcctctctggacagggcctttgcggcgctggcg
gaacgctgggggcatctcgacatcctcgttcacgccatcgccttttccagcaaggatgag
ctgaccggccggttcgtcgataccagccgggcgaacttcaagaactcgctggacatctcg
tgctattcgctgatcgaggtggcgcgccggtcgctgccgctgatgaacgcgggcggcacc
atcctgacgctgacctatggcgggtcgaaccgggtgacgcccttctacaacgtcatgggc
gtggccaaggcggcgctggaatcggcggtgcgctatctggcgaacgatcttggcccgcag
ggcatccgcgtcaacgccatcagccccggcccgatgaagacgctggccggcgcggcgatc
ggcggcgcgcgcaagacctatcgccataccgaggcgaacgcgccgctgcgcgccaatgcc
acgcttgaggcgatcggcgggacggcggtgtggctggcatccgactggggcgcctgcacg
acgggcgaggttgtcctcgtcgatggcggctatcacgttctggggatgccgcagtccgat
aacctgtga

DBGET integrated database retrieval system