KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_07090Help
Entry
JM49_07090        CDS       T03338                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Brite
Enzymes [BR:pcp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     JM49_07090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIS11458
UniProt: A0A1E1G2G2
LinkDB All DBs
Position
complement(1516971..1517567)
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLAPNAGGQPTGALAEAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWKFVAEQFEGKTFVA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgcacacgatgccctgcagccgcacatttcc
aaggaaactctggaataccaccacgacaagcaccacaacacctatgtcgtgaacctgaac
aacctggtgccaggcaccgagttcgaaggcaaaaccctggaagagatcgtcaagtcttcc
tcgggcggtatcttcaacaacgccgctcaggtctggaaccacactttctactggaactgc
ctggcgccaaacgctggcggtcaaccaaccggcgcactggccgaggccatcaacgcggct
ttcggttcgttcgacaagttcaaggaagaattcaccaagacttccgtcggcaccttcggt
tccggttggggctggctggtgaaaaaggctgacggttccctggccctggccagcaccatc
ggcgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcttactacatcgactaccgcaacctgcgtcccaagtacgtcgaagcgttctggaac
ctggtcaactggaaattcgtggccgagcagttcgaaggcaagaccttcgtcgcctaa

DBGET integrated database retrieval system