KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_14040Help
Entry
JM49_14040        CDS       T03338                                 

Definition
(GenBank) MFS transporter
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like LacY_symp MFS_5
Motif
Other DBs
NCBI-ProteinID: AIS12743
LinkDB All DBs
Position
complement(3043463..3044731)
Genome map
AA seq 422 aa AA seqDB search
MAYNNNKAGYENILLGVLFLTFGFVFFDRLALSFLFPFMADELQLSNSHLGMLSSVLALA
WAVSGALVGAWSDRRGKRKPLLIVAVILFSLCSALSGLVTGFLSLLLFRGIMGLAEGPIL
PLSQSLMVEASSPHRRGLNMGLLQGSAAGLLGAVIGPPVLIGLAEAYGWRHAFIVSLIPG
LLIALLIWRYVRNDAPPAPATTSDSGKAPVNRLALLKSRNIVLCTLISCVFLTWFVILIS
FTPTFLVKVRGYSPASMGTVMSCLGGAWVLWGFGVAAISDRFGRRPTLVLFSLIAACCPI
ALLYANSPLLMGVLMLLTYTGLGCFTLFMATIPAETVPREVMATALGMIMGIGELVGGFV
SPTIAGFAADRFGLSIVMWISCGGALLAALLALFLKETAPAVLARGRRAEPSPSSVLQGN
QP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaacaacaataaagccggttacgagaacatcctgctgggcgtgctgttcctg
acgttcggtttcgtctttttcgatcgcctggccctgtccttcctgtttcctttcatggcc
gacgagctgcaactgagcaatagccacctgggcatgctgtcgtcggtcctggccctggcc
tgggcggtgtccggcgcgctggtcggggcctggtcggaccggcgtggcaagcgcaagccg
ctgctgatcgtcgcggtgatcctgttttccctgtgctcggcgctgtcggggctggtcacc
ggttttctcagcctgctgctgttccgcggcatcatgggcctggccgaagggccgatcctg
ccgctctcgcaatcgctgatggtggaggcctcctcgccccatcgccggggcctgaacatg
ggcctgctgcaaggctcggcggccgggctgctgggcgcagtgatcggcccgccggtgctg
atcggcctggccgaagcctacggctggcgccatgcctttatcgtctcgctgatccccgga
ttgctgatcgccctgctgatctggcgctacgtgcgcaacgacgcgccgccagcaccagca
accaccagcgacagcggtaaagctccggtcaatcgcctggctttactgaaaagccgcaac
atcgtgctctgcaccctgatcagttgcgtgttcctcacctggttcgtgatcctcatctcc
tttaccccgaccttcctggtcaaggtccgcggctacagcccggcgagcatgggcacggtg
atgagctgcctgggcggcgcctgggtgctgtggggcttcggcgtggcggcgatttccgac
cgcttcggccggcgcccgaccctggtgctgttctcgctgatcgccgcctgctgcccgatc
gccctgctctacgccaacagcccgctgctgatgggcgtgctgatgctgctgacctacacc
ggccttggctgcttcaccctgttcatggcaaccatcccggcggaaaccgtgccccgcgag
gtcatggccaccgccctgggcatgatcatgggcatcggcgagctggtgggcggcttcgtc
tcgccgaccatcgccggcttcgccgccgaccgtttcggcctgtccatcgtcatgtggatc
tcctgcggcggcgccctgctggccgcgctgctggcgctgttcctcaaggaaaccgcgccg
gcggtcctggcccgcgggcgccgcgccgaaccttccccgtcttccgtcctgcaaggaaac
cagccatga

DBGET integrated database retrieval system