KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_14045Help
Entry
JM49_14045        CDS       T03338                                 

Definition
(GenBank) 2,4-dihydroxyacetophenone dioxygenase
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    JM49_14045
Enzymes [BR:pcp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     JM49_14045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7
Motif
Other DBs
NCBI-ProteinID: AIS12744
UniProt: A0A1E1FYC2
LinkDB All DBs
Position
complement(3044771..3045304)
Genome map
AA seq 177 aa AA seqDB search
MPEAASREFWKDLQPIANCFKPDAKPEVYLANAASDDLKLYVPFTETVSSRPLWISPSEN
RWCDILMASSAGLVNRHYHPHEVFAYTLSGKWGYLEHDWTATAGDFVYETPGEGHTLVAY
EHEQPMRAFFIVKGPLIWLDEQGEPEGYFDVHSYIAMCRAHYEKIGLGAAYIDTLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagccgccagccgtgaattctggaaagacctgcaaccgatcgccaattgcttc
aagccggacgccaagcccgaggtctacctggccaatgccgccagcgacgacctgaagctc
tatgtgcccttcaccgaaaccgtgtcctcgcggccgctgtggatctcgccgagcgagaac
cgctggtgcgacatcctcatggccagcagcgccgggctggtgaaccggcattaccacccc
cacgaagtgttcgcctacaccctgtccggcaagtggggctacctggagcacgactggacc
gccaccgccggcgacttcgtctacgagaccccgggcgaaggccacaccctggtggcctac
gagcacgaacagccgatgcgtgcgttcttcatcgtcaagggcccgctgatctggctcgac
gaacagggcgagccggagggttatttcgacgtgcactcctacatcgccatgtgccgcgcg
cactacgaaaaaatcggcctcggcgcggcctatatcgacacgctgtttcgctga

DBGET integrated database retrieval system