KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_14085Help
Entry
JM49_14085        CDS       T03338                                 

Definition
(GenBank) Pyoverdin chromophore biosynthetic protein pvcC
  KO
K00483  4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.9]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00350  Tyrosine metabolism
pcp01100  Metabolic pathways
pcp01120  Microbial metabolism in diverse environments
pcp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    JM49_14085
Enzymes [BR:pcp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     JM49_14085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB_N HpaB
Motif
Other DBs
NCBI-ProteinID: AIS12752
UniProt: A0A3G7M0D4
LinkDB All DBs
Position
complement(3053462..3055024)
Genome map
AA seq 520 aa AA seqDB search
MKPEDFRAETNRPLTGAEYLASLRDDREIYIYGDRVKDVTSHPAFRNSAASMARLYDALH
DPETKDKLCWDTDTGNGGYTHKFFRSAKSADDLRQQRDAIAEWSRLTYGWMGRSPDYKAA
FGSALGANPEFYGQFADNARTWYKRIQEACLYLNHAIVNPPIDRDKPVDQVKDVFISVDE
EVEGGIIVSGAKVVATNSALTHYNFVGQGSAQLLGDNTDFALMFIAPMNTRGMKLICRPS
YELQAGMTGSPFDYPLSSRFDENDAILIMDKVFIPWENVLIYRDFERCRQWFPQGGFGRL
FPMQGCTRLAVKLDFITGLLVKALQCTGSLEFRGVQAQVGEVVAWRNLFWSLTDAMHGNA
SEWLNGAFLPSAQALQAYRVLAPQAYTDIKKIIEQVVASGLIYLPSGSRDLKDPVLNQYL
STYCRGSAGMGHEERIKILKLLWDAIGTEFGGRHELYEINYAGSQDEIRMQCLRHAQATG
SMKTMTELVDKCLGDYNLDGWTVPHLTNPDDINMLDRIRQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgaagacttccgtgccgagaccaaccgcccgctgaccggcgccgaatacctg
gccagcctgcgcgatgatcgcgaaatctacatttatggcgaccgggtcaaggacgtgacc
agccacccggcgttccgcaattccgccgcctccatggcgcgcctctatgacgccctgcac
gaccccgaaaccaaggacaagctgtgctgggacaccgacaccggcaacggcggctacacc
cacaagttcttccgttcggcgaaaagcgccgacgacctgcgccagcagcgcgatgccatc
gccgagtggtcgcgcctgacctatggctggatgggccgcagcccggactacaaggccgcc
ttcggcagtgccctgggcgccaacccggagttctacggccagttcgcggacaatgcccgc
acctggtacaagcgcatccaggaagcctgcctgtacctcaaccacgccatcgtcaacccg
ccgatcgaccgcgacaaaccggtggaccaggtcaaggacgtgttcatctcggtggacgag
gaagtcgagggcgggatcatcgtcagcggcgccaaggtggtggccaccaactcagccctg
acccactacaacttcgtcggccagggttcggcgcagcttctgggcgacaacaccgacttc
gccctgatgttcatcgcgccgatgaacacccgcggcatgaagctgatctgccgcccgtcc
tatgaactgcaggccggcatgaccggctcgccgttcgactacccgctgtccagccgcttc
gacgagaacgacgcgatcctgatcatggacaaggtgttcatcccctgggaaaacgtgctg
atctaccgcgacttcgagcgctgccggcagtggttcccgcaaggcggtttcggccggctg
ttcccgatgcagggctgtacccggctggcggtcaagctcgacttcatcactggcctgctg
gtcaaggccttgcagtgcaccggttccctggagtttcgcggggtgcaggcgcaggtcggc
gaggtggtggcctggcgcaacctgttctggtcgctgaccgatgccatgcacggcaacgcc
agcgaatggctcaatggcgccttcctgcccagcgcccaggccttgcaggcctaccgggta
ctggcgccccaagcctacaccgatatcaagaagatcatcgaacaggtggtggccagcggc
ctgatctacctgccgtccggctcccgcgacctcaaggacccggtcctcaaccagtacctg
agcacctattgccggggctcggcgggcatgggccacgaggagcggatcaagatcctcaag
ctgctgtgggatgccatcggcaccgagttcggcggccgccacgagctgtacgaaatcaac
tacgccggcagccaggacgaaatccgcatgcagtgcctgcgccatgcccaggccaccggc
tcgatgaaaaccatgaccgaattggtggacaaatgcctgggcgactacaatctcgacggc
tggacggtgccacacctgactaatccggacgacatcaacatgctcgaccgcatccgccag
taa

DBGET integrated database retrieval system