KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_15515Help
Entry
JM49_15515        CDS       T03338                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: AIS13013
LinkDB All DBs
Position
complement(3396551..3397519)
Genome map
AA seq 322 aa AA seqDB search
MDYRRLGRSGLKVSAIALGTAQCDWWVDEATSRRLFDTYVESGGNLIDTADVYPVFADGV
GGKASEEFVGRWLQTTTKRHEVLLSTKVSGRMGPGPNDQGLSWRHIVKAVEGSLSRLQVD
CIDLYQAHDDYDDVPVEETLRAFDHLVQRGLVRYVGCSNFKAWRLMKSLAISERSALAGY
VSVQERYNLLERDRIESELQPLCVEEGVGLLPYNPLAKGFLCGRYQQQAALPGSPRAAGV
QRDYFNARNWQALEVLRRIAQERDSSCTQVALAWLLSRPAVVAPVVGASSVEQLREIMAA
PQLQLSQADLYQLNQVSAAPVV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggattacaggcgtcttggccgttcagggctgaaggtttccgccattgcgctgggaacc
gcgcaatgcgactggtgggtggatgaagcgacatcgcgcaggttgttcgatacctacgtc
gagtcaggcggcaacctgatcgacaccgccgatgtctatccggtctttgccgacggggtg
ggtggcaaggcctcggaggagttcgtcgggcgctggttgcagaccacgaccaagcggcac
gaggtgctgctgtcgaccaaggtgtccgggcgcatggggccagggccgaatgaccagggg
ctttcctggcggcatatcgtcaaggctgtcgaaggttccttgagccgcttgcaagtcgac
tgcatcgacctgtatcaggcgcatgacgactacgacgatgtcccggtggaggagacgcta
cgggccttcgaccatctggtgcagcgtgggctggttcgttatgtggggtgctccaacttc
aaggcctggcggttgatgaagtcgctggcgatcagcgagcgctcggccctggcgggctat
gtcagcgtccaggaacgctacaacctgctggagcgtgatcgaatcgagtccgaactgcag
ccgctgtgcgtggaggagggggtcggtctgttgccctacaaccccttggccaagggcttt
ctctgcggccgctaccaacagcaggcagccttgccgggctcgcctcgcgcggcgggcgtg
cagcgagactacttcaacgcccggaactggcaggccctcgaggtgctgcggcggatcgcc
caggagcgcgacagcagctgcacccaggttgccctggcctggctgttgtctcgccccgcc
gtggtcgcacccgtggtgggagccagctcggtcgagcaactgcgggagatcatggcggcc
ccgcagttgcagctgtcgcaggccgatctgtatcagttgaaccaggtaagcgccgcgccc
gtggtctga

DBGET integrated database retrieval system