KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_23855Help
Entry
JM49_23855        CDS       T03338                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JM49_23855
Enzymes [BR:pcp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     JM49_23855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AIS14583
UniProt: A0A1E1FRY5
LinkDB All DBs
Position
5226632..5227276
Genome map
AA seq 214 aa AA seqDB search
MIDLYYWTTPNGHKISLFLEETGLPYSVHPVNIGQGEQFKPEFLKIAPNNRIPAIVDHQP
ADGGAPLSLFESGAILLYLAEKTGQFLPKDLRGRQEALQWLFWQMGGLGPMAGQNHHFSQ
FAPEKIPYAIKRYVDETARLYGVLDRRLADRDFVAGSEYSIADMAIYPWIVSHKWQSQNL
EDFPNLHRWFNRILDRPATARAYAIAARINPPKS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctgtattactggaccacccccaacggccacaagatttccctgttcctcgag
gaaaccggcctgccctacagcgtgcacccggtcaacattggccagggcgagcagttcaag
cccgagttcctgaagatcgcgccgaacaaccggatccccgccatcgtcgatcatcagccg
gccgatggcggcgcgccgctgtcgctgttcgagtccggggcgattctgctgtacctggcg
gaaaagaccgggcagttcctgcccaaggacctgcgtggccgtcaggaagccttgcagtgg
ctgttctggcagatgggcggcctgggaccgatggccgggcagaaccaccatttcagccag
ttcgccccggagaaaatcccttacgcgatcaaacgctacgtcgatgaaaccgcgcgcttg
tacggggtgctggaccgacgcctggcggatcgcgatttcgtcgccggcagcgaatacagc
atcgccgacatggcgatctatccgtggatcgtctcccacaagtggcaaagccagaacctg
gaagacttccccaacctgcaccgctggttcaaccgcatcctcgatcgccccgcgaccgcg
cgcgcctatgccatcgccgcgcggatcaacccacccaaatcctga

DBGET integrated database retrieval system