KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_24370Help
Entry
JM49_24370        CDS       T03338                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00061  Fatty acid biosynthesis
pcp00780  Biotin metabolism
pcp01100  Metabolic pathways
pcp01212  Fatty acid metabolism
Module
pcp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JM49_24370
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JM49_24370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pcp01004]
    JM49_24370
Enzymes [BR:pcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     JM49_24370
Lipid biosynthesis proteins [BR:pcp01004]
 Fatty acid synthase
  Component type
   JM49_24370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AIS14682
UniProt: A0A1E1FSA3
LinkDB All DBs
Position
complement(5324082..5324522)
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVVDLDVEGKCIRAYKNVSINEPFFNGHFPAHPIMPGVL
IIEAMAQAAGILGFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLILEAKFISCKRQI
WKFECQASVDGKPVCSAEIICAERKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgagattcgcgaatacctgcctcaccgttacccgttcctgttggtg
gaccgggtagtggacctggatgttgagggcaagtgcattcgtgcctacaagaatgtcagc
atcaacgaacctttcttcaatggtcacttccctgcgcatccaatcatgccgggcgtgctg
atcatcgaagccatggctcaggctgcgggcattcttggtttcaagatgctggacgtgaag
ccggccgatggcaccctctactacttcgtcggttccgacaagctgcgcttccgccagccg
gtactgccgggtgaccagttgatcctggaagccaagttcatcagctgcaagcgccagatc
tggaaattcgaatgccaggcttcggtcgacggcaagccagtctgctccgctgaaatcatc
tgtgcggaacgcaaactatga

DBGET integrated database retrieval system