KEGG   Pseudomonas citronellolis: PcP3B5_06880Help
Entry
PcP3B5_06880      CDS       T04637                                 

Gene name
gph_1
Definition
(GenBank) Phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00630  Glyoxylate and dicarboxylate metabolism
pcq01100  Metabolic pathways
pcq01110  Biosynthesis of secondary metabolites
pcq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PcP3B5_06880 (gph_1)
Enzymes [BR:pcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     PcP3B5_06880 (gph_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6 Put_Phosphatase
Motif
Other DBs
NCBI-ProteinID: AMO74192
UniProt: A0A127MLM6
LinkDB All DBs
Position
758313..759137
Genome map
AA seq 274 aa AA seqDB search
MSAAQALFAGRLPRLVMFDLDGTLVDSVPDLAAAVDKALLGMGRAPAGLEQVRHWVGNGA
RVLVRRALAGGIEHEGVSEEDTERALALFMDAYADSHALTEVYPGVVDTLKWLKKQGVEL
ALITNKPERFVAPLLDEMGLGKFFRWIVGGDTLPQQKPDPAALLFVMKAAGVAPGEALFV
GDSRNDVLAAKAAGVRSVGLTYGYNHGRPIAEEQPSLVLDDLRQLLPCFDPGKAIVLPDD
GSNPAHRDSNVLDTAPRKLWMKVIKALARWRWRA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgcccaagcgctgttcgccgggcgcctgccgcgcctggtgatgttcgacctg
gacggcaccctggtggactcggtgccggacctggccgccgcggtggacaaggccctgctc
ggcatgggccgcgctcccgccgggcttgagcaggtgcgccactgggtcggcaacggcgcc
cgggtgctggtgcgccgcgccctggccggcggcatcgagcatgaaggcgtcagcgaggag
gataccgagcgcgccctggcgctgttcatggacgcctacgccgacagccacgcgctcacc
gaggtctaccccggcgtggtggacaccctgaaatggctgaagaaacagggcgtggagctg
gcgctgatcaccaacaagcccgagcgcttcgtcgccccgctgctggacgagatgggcctg
ggcaagttcttccgctggatcgtcggcggcgacaccctgccgcagcagaagcccgacccg
gccgcgctgctgttcgtgatgaaggctgccggcgttgcgcccggcgaggcgctgttcgtc
ggcgactcgcgcaacgacgtgctggccgccaaggccgccggggtgcgcagcgtcggcctg
acctacggctacaaccacggccggccgatcgccgaggagcagccgagcctggtgctggac
gacctgcgccaactgctgccttgcttcgacccgggcaaagcgatagtgttgccggacgac
ggttccaaccccgcccatcgagactccaacgtgctggacacggctccccgcaaactctgg
atgaaagtcatcaaggccctggcccgctggcgctggcgcgcctga

DBGET integrated database retrieval system