KEGG   Pseudomonas citronellolis: PcP3B5_12230Help
Entry
PcP3B5_12230      CDS       T04637                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00473  D-Alanine metabolism
pcq00550  Peptidoglycan biosynthesis
pcq01100  Metabolic pathways
pcq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PcP3B5_12230 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PcP3B5_12230 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PcP3B5_12230 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pcq01011]
    PcP3B5_12230 (ddl)
Enzymes [BR:pcq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PcP3B5_12230 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:pcq01011]
 Precursor biosynthesis
  Amino acid ligase
   PcP3B5_12230 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter ATPgrasp_YheCD ATPgrasp_ST GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AMO74701
UniProt: A0A127MNL3
LinkDB All DBs
Position
1313493..1314440
Genome map
AA seq 315 aa AA seqDB search
MNDALKSTLEPRAFGRVAVLYGGRSAEREVSLKSGGMVLKALQDAGVDAFGIDVGDDLLQ
RLLSEKIDRAFIILHGRGGEDGSMQGLLEVAGIPYTGSGVLASALAMDKLRTKRVWLSLG
LPTPAYAVLASGDDCRRAATELGFPLIVKPAHEGSSIGMAKVDGVDALIAAWRSAAEYDS
QVLVEQWISGPEFTVATLRGQVLPAIGLGTPHSFYDYDAKYLASDTQYRIPCGLSPEKER
ELQDLCARACEALGIQGWGRTDVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAGLDFQ
QLVLAILADSVEARG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcactcaaatccaccctcgagccccgcgccttcggccgcgtcgccgtgctc
tacggcggcaggagcgccgagcgcgaggtctcgctgaagtccggcggcatggtcctcaag
gccctgcaggatgccggggtggacgccttcggcatcgacgtgggcgacgacctgctgcag
cgcctgctgagcgagaagatcgaccgcgccttcatcatcctccacggccgtggcggcgag
gacggcagcatgcagggcctgctggaagtcgccggcattccctacaccggcagcggcgtg
ctggcttcggccctggccatggacaagctgcgcaccaagcgggtgtggctgagcctgggc
ctgccgacgccggcctatgccgtgctggccagcggggacgactgccgccgcgccgcgacg
gaactgggcttcccgttgatcgtcaagccggcccatgaaggctccagcatcggcatggcc
aaggtcgacggcgtggacgcgctgatcgccgcctggcgcagcgccgccgaatacgactcg
caagtgctggtcgagcagtggatcagcggccccgagttcaccgtggccaccctgcgcggc
caggtgctgccggccatcggcctgggcactccgcacagcttctacgactacgacgccaag
tacctggccagcgacacccagtaccgcatcccctgcggcctgagccccgagaaggagcgc
gagctgcaggacctgtgcgcccgcgcctgcgaggccctgggcatccagggctgggggcgg
accgacgtgatgcaggacgccgaggggcgtttctggctgctcgaagtcaacaccgcaccg
ggcatgaccgaccacagcctggtgcccatggccgcgcgcgcggccggcctggatttccag
caactggtgctggcgatcctcgccgacagcgtcgaggcaagggggtaa

DBGET integrated database retrieval system