KEGG   Pseudomonas citronellolis: PcP3B5_19130Help
Entry
PcP3B5_19130      CDS       T04637                                 

Gene name
fadB_2
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00071  Fatty acid degradation
pcq00280  Valine, leucine and isoleucine degradation
pcq00281  Geraniol degradation
pcq00310  Lysine degradation
pcq00362  Benzoate degradation
pcq00380  Tryptophan metabolism
pcq00410  beta-Alanine metabolism
pcq00640  Propanoate metabolism
pcq00650  Butanoate metabolism
pcq00903  Limonene and pinene degradation
pcq00930  Caprolactam degradation
pcq01100  Metabolic pathways
pcq01110  Biosynthesis of secondary metabolites
pcq01120  Microbial metabolism in diverse environments
pcq01130  Biosynthesis of antibiotics
pcq01200  Carbon metabolism
pcq01212  Fatty acid metabolism
Module
pcq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PcP3B5_19130 (fadB_2)
   00650 Butanoate metabolism
    PcP3B5_19130 (fadB_2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PcP3B5_19130 (fadB_2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PcP3B5_19130 (fadB_2)
   00310 Lysine degradation
    PcP3B5_19130 (fadB_2)
   00380 Tryptophan metabolism
    PcP3B5_19130 (fadB_2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PcP3B5_19130 (fadB_2)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PcP3B5_19130 (fadB_2)
   00281 Geraniol degradation
    PcP3B5_19130 (fadB_2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PcP3B5_19130 (fadB_2)
   00930 Caprolactam degradation
    PcP3B5_19130 (fadB_2)
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PcP3B5_19130 (fadB_2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PcP3B5_19130 (fadB_2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PcP3B5_19130 (fadB_2)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PcP3B5_19130 (fadB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AMO75367
UniProt: A0A127MQ39
LinkDB All DBs
Position
2064748..2066895
Genome map
AA seq 715 aa AA seqDB search
MIYQGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELREAVDAIKADASVKGVIVTS
GKGVFIVGADITEFVDNFKLPDEELLAGNLEANKIFSAFEDLEVPTVAAINGIALGGGLE
MCLAADFRVMSATAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDAL
KVGAVDAVVAPEQLQAAALDLVKRAIAGELDHKARRQPKLEKIKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKSIQKAANFGRDKALEVEAQGFVKLAKTSVAQSLIGLFLNDQEL
KKKAKQYDEVAKDVKLAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEGIQMGLNEASKL
LGKRVEKGRLTPAKMAEALNAIRPTMSYGDFGNVDIVVEAVVENPKVKQIVLAEVEGVVK
EDAILASNTSTISISLLAQALKRPENFVGMHFFNPVHMMPLVEVIRGEKSGEVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFSKLLGFGVDFARIDKVMEKFGWPMGPAYL
SDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKRGKP
KKVSDPQAYELLKAIVSEQRELTDEDIINYMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADKYADLGPLYHPTAKLREMAKNGQKFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaaggtaaagccatcacggttaaggctcttgagagcggcatcgtcgagctg
aatttcgacctcaagggcgagtccgtcaacaagttcaaccggctcaccctgaacgaactg
cgtgaagcagtcgatgcgatcaaggccgatgcgtccgtcaagggcgtgatcgtgaccagc
ggcaaaggcgtgttcatcgtcggcgccgacatcaccgaattcgtcgacaacttcaagctg
ccggacgaagaactgctggccggcaacctcgaagccaacaagatcttcagcgccttcgag
gacctcgaggtcccgaccgtcgccgcgatcaacggcatcgccctgggcggcggcctggaa
atgtgcctggccgcggacttccgcgtgatgagcgccaccgccaagatcggcctgccggaa
gtcaagctgggcatctacccgggcttcggcggcaccgtgcgcctgccgcgcctgatcggc
gtggacaacgccgtcgagtggatcgcctcgggcaaggaaaaccgtgccgaggacgccctg
aaggtcggcgccgtcgacgccgtggtcgcccccgagcagctgcaggccgcggccctggac
ctggtcaagcgcgccatcgccggcgagctggaccacaaggcccgccgccagcccaagctg
gaaaagatcaagctcaacgccatcgagcagatgatggccttcgagaccgccaagggcttc
gtcgctggccaggccggcccgaactacccggccccggtcgaagccatcaagtcgatccag
aaggctgccaacttcggccgtgacaaggcgctggaagtcgaggcccagggcttcgtcaag
ctggccaagacctcggttgcgcaaagcctgatcggcctgttcctgaacgaccaggaactg
aagaagaaagccaagcagtacgacgaagtcgccaaggacgtgaaactggccgccgtgctc
ggcgccggcatcatgggcggcggcatcgcctaccagtcggcggtcaagggcaccccgatc
ctgatgaaggatatccgcgaagagggtatccagatgggcctgaacgaggcctccaagctg
ctcggcaagcgcgtcgagaagggccgcctgaccccggccaagatggccgaggcgctgaac
gccatccgcccgaccatgtcctacggcgacttcggcaacgtcgacatcgtcgtcgaagcc
gtggtcgagaaccccaaggtcaagcagatcgtgctggccgaggtggaaggcgtggtgaag
gaggacgcgatcctcgcttccaacacctcgaccatctccatcagcctgctggcccaggcg
ctgaagcgcccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccc
ctggtcgaggtcatccgcggcgagaagtccggtgaagtggccgtcgccaccaccgtggcc
tacgccaagaagatgggcaagaaccccatcgtggtgaatgactgccccggcttcctggtc
aaccgcgtgctgttcccgtacttcggcggcttctccaagctgctgggcttcggcgtcgac
ttcgcgcgcatcgacaaggtcatggagaagttcggctggcccatgggcccggcctacctg
tccgacgtggtcggcatcgacaccggccaccatggccgcgacgtgatggccgaaggcttc
ccggaccgcatggcggtggaaggcaagaccgccgtcgacgtcatgtacgaggccaaccgc
ctgggccagaagaacggcaagggcttctacgcctacgagaccgacaagcgcggcaagccg
aagaaggtcagcgacccgcaggcctacgaactgctcaaggccatcgtcagcgagcagcgt
gagctgaccgacgaggacatcatcaactacatgatgatcccgctgtgcctggagaccgtg
cgctgcctggaagacggcatcgtcgaaaccgccgccgaggccgacatgggcctgatctac
ggcatcggcttcccgcccttccgtggtggtgcgctgcgctacatcgactccatcggcgtg
gccgaattcgtcgccctggccgacaagtacgccgacctgggcccgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaacggccagaagttcttcggttga

DBGET integrated database retrieval system