KEGG   Pseudomonas citronellolis: PcP3B5_23730Help
Entry
PcP3B5_23730      CDS       T04637                                 

Gene name
sdhA_1
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00020  Citrate cycle (TCA cycle)
pcq00190  Oxidative phosphorylation
pcq00650  Butanoate metabolism
pcq01100  Metabolic pathways
pcq01110  Biosynthesis of secondary metabolites
pcq01120  Microbial metabolism in diverse environments
pcq01130  Biosynthesis of antibiotics
pcq01200  Carbon metabolism
Module
pcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pcq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PcP3B5_23730 (sdhA_1)
   00650 Butanoate metabolism
    PcP3B5_23730 (sdhA_1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PcP3B5_23730 (sdhA_1)
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PcP3B5_23730 (sdhA_1)
    1.3.5.4  fumarate reductase (quinol)
     PcP3B5_23730 (sdhA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_3 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMO75814
UniProt: A0A127MR75
LinkDB All DBs
Position
2567966..2569738
Genome map
AA seq 590 aa AA seqDB search
MASIRTLSFDAIIVGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEQGRIYQRP
FGGQSKDFGKGGQAARTCAAADRTGHALLHTLYQANLKNGTSFLNEWYAVDLVKNQDGHV
VGIIAIDIETGDTIYIRSKAVVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEV
IAGNGVGPNKDHVLLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPIPVIPTCHYMMG
GVATNIHGQALTMDANGNDQIVEGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRATGLH
LEKALKEGIEHRGASESDLEASFKRLNGVNERTSGEEVAPLKRELQQCMQNYFGVFRTGE
YMQKGIAQLADLRERIATVKINDKSQAFNTARIEALELQNLLEVAEATAIAAENRKESRG
AHAREDFEERDDENWLCHTLYFPGEKRVAKRAVNFAPKTVPAFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcattcgcactctctccttcgacgccatcatcgtgggtggcggcggcgccggc
atgcgtgccgcgctgcaactggcccagggtggtcacaagaccgccgtggtgaccaaggtc
ttcccgacccgttcgcacaccgtttccgcccagggcggcatcacctgcgccatcgcctcg
gccgacccgaacgacgactggcgctggcacatgtacgacaccgtcaagggctccgactac
atcggtgaccaggacgccatcgaatacatgtgctccgtcggcccggaagccgtgttcgag
ctggaacacatgggcctgccgttctcccgtaccgagcagggccgcatctaccagcgtccg
ttcggtggccagtccaaggacttcggcaagggggggcaggccgcccgtacctgcgccgcg
gccgaccgtaccggtcacgccctgctgcacaccctgtaccaggccaacctgaagaacggc
acctccttccttaatgagtggtacgccgtcgacctggtgaagaaccaggacggccacgtg
gtcggcatcatcgccatcgacatcgagaccggcgacaccatctatatccgctccaaggcc
gtggtcctggccaccggcggtgcaggccgtatctacgcctccaccaccaacgccctgatc
aacaccggcgacggcgtgggcatggccctgcgcgccggcgtaccggtgcaggacatcgag
atgtggcagttccacccgaccggcatcgccggcgccggtgtactggtcaccgaaggctgc
cgcggtgaaggcggctacctgatcaacgcccatggcgagcgcttcatggagcgttacgcg
ccgaacgccaaggacctggccggccgcgacgtggtcgcccgctccatggtcaaggaagtg
atcgccggcaacggcgtgggcccgaacaaggaccacgtgctgctgaagctcgaccacctg
ggcgaggaagtcctgcacagccgcctgcccggcatctgcgagctgtccaagaccttcgcc
cacgtcgacccggtggtcgcgcccatcccggtcatcccgacctgccactacatgatgggc
ggcgtcgccaccaacatccatggccaggccctgaccatggacgccaacggcaacgaccag
atcgtcgaaggcctgttcgcggtcggcgaagtcgcctgcgtatcggtacacggcgccaac
cgcctgggcggcaactcgctgctcgacctggtggtcttcggccgcgctaccggcctgcac
ctggaaaaggccctgaaagagggcatcgagcaccgcggcgcctccgagtccgacctggaa
gcctccttcaagcgcctgaacggcgtgaacgagcgcaccagcggcgaagaagtcgccccg
ctcaagcgcgaactgcagcagtgcatgcagaactacttcggtgtattccgtaccggcgaa
tacatgcagaagggtatcgctcaactggctgacctgcgcgagcgtatcgccaccgtcaag
atcaacgacaagagccaggctttcaacacggcgcgcatcgaagcgctggaactgcagaac
ctcctcgaggtggccgaagccaccgccattgcggccgaaaaccgcaaagagtcccgcggc
gcccatgcccgcgaagacttcgaggagcgcgatgacgagaactggctgtgccacaccctg
tacttcccgggtgagaagcgcgttgccaagcgtgccgtcaacttcgcgccgaagaccgtt
ccggcattcgaacccaaggttcgtacttactaa

DBGET integrated database retrieval system