KEGG   Pseudomonas citronellolis: PcP3B5_23740Help
Entry
PcP3B5_23740      CDS       T04637                                 

Gene name
sdhB_1
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00020  Citrate cycle (TCA cycle)
pcq00190  Oxidative phosphorylation
pcq00650  Butanoate metabolism
pcq01100  Metabolic pathways
pcq01110  Biosynthesis of secondary metabolites
pcq01120  Microbial metabolism in diverse environments
pcq01130  Biosynthesis of antibiotics
pcq01200  Carbon metabolism
Module
pcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pcq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PcP3B5_23740 (sdhB_1)
   00650 Butanoate metabolism
    PcP3B5_23740 (sdhB_1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PcP3B5_23740 (sdhB_1)
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PcP3B5_23740 (sdhB_1)
    1.3.5.4  fumarate reductase (quinol)
     PcP3B5_23740 (sdhB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AMO75815
UniProt: A0A127MRR3
LinkDB All DBs
Position
2569750..2570457
Genome map
AA seq 235 aa AA seqDB search
MLKVSVYRYNPEKDSAPYMQDFDVDTQGKDVMVLDVLALIKEQDEGFSYRRSCREGVCGS
DGMNINGKNGLACITPLSAAGLKGGKLVLRPLPGLPVIRDLVVDMRIFYKQYESVKPYLQ
NKYAAPAIERLQTPEEREKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLA
DSRDTETQARLASLDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHIRNMLLQSGT
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtaagtgtttaccgctacaacccggagaaggactctgcaccctacatgcag
gacttcgacgtcgatacccagggcaaggacgtgatggtcctggacgtgctggcgctgatc
aaggaacaggacgagggcttctcctatcgtcgctcctgccgtgaaggcgtttgcggctcc
gacggcatgaacatcaacggcaagaacggcctggcctgcatcactccgctgtcggccgcc
ggcctgaagggcggcaagctggtgctgcgcccgctgccgggcctgccggtgatccgtgac
ctggtcgtcgatatgcgcatcttctacaagcagtacgagagcgttaagccgtatctgcag
aacaagtatgccgcgccggcgatcgaacgcctgcaaacccccgaagagcgcgaaaagctg
gacggtctgtacgagtgcatcctgtgcgcctgctgctcgacctcctgcccgtcgttctgg
tggaacccggacaagttcctcggccccgccgcgctgctgcaggcctatcgcttcctggcc
gacagccgcgacacggaaacccaggcgcgcctggccagcctggacgatccgttcagcgtg
ttccgttgccgtggaatcatgaactgcgtgaatgtctgcccgaaaggcctgaacccgacc
aaggccatcggtcacattcgcaacatgctgctgcagagcgggacctga

DBGET integrated database retrieval system