KEGG   Pseudomonas citronellolis: PcP3B5_25300Help
Entry
PcP3B5_25300      CDS       T04637                                 

Definition
(GenBank) Phenol hydroxylase subunit
  KO
K16249  phenol/toluene 2-monooxygenase (NADH) P0/A0
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00361  Chlorocyclohexane and chlorobenzene degradation
pcq00362  Benzoate degradation
pcq00623  Toluene degradation
pcq01100  Metabolic pathways
pcq01120  Microbial metabolism in diverse environments
pcq01220  Degradation of aromatic compounds
Module
pcq_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PcP3B5_25300
   00361 Chlorocyclohexane and chlorobenzene degradation
    PcP3B5_25300
   00623 Toluene degradation
    PcP3B5_25300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phenol_hyd_sub
Motif
Other DBs
NCBI-ProteinID: AMO75967
UniProt: A0A127MRV8
LinkDB All DBs
Position
2792270..2792521
Genome map
AA seq 83 aa AA seqDB search
MNATPFDQMPRYVRVRSEPDAAFVEFDFAIGYPDLFVELVLPRAAFASFCRSNRVHHMDA
QMAAAIDADMQKWRYGESRGQDD
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccacccccttcgaccagatgccccgctacgtgcgggttcgcagcgagccggac
gcggccttcgtcgagttcgacttcgccatcggctacccggacctcttcgtcgagctggtg
ttgccgcgtgcggccttcgccagcttctgccggagcaaccgggtgcatcacatggacgcg
cagatggccgccgccatcgacgccgacatgcagaaatggcgctacggcgaaagccgtggc
caggacgactga

DBGET integrated database retrieval system