KEGG   Pseudomonas citronellolis: PcP3B5_26800Help
Entry
PcP3B5_26800      CDS       T04637                                 

Gene name
ygcS_1
Definition
(GenBank) Inner membrane metabolite transport protein YgcS
  KO
K08368  MFS transporter, putative metabolite transport protein
Organism
pcq  Pseudomonas citronellolis
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcq02000]
    PcP3B5_26800 (ygcS_1)
Transporters [BR:pcq02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Others
    PcP3B5_26800 (ygcS_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-ProteinID: AMO76114
UniProt: A0A127MS04
LinkDB All DBs
Position
complement(2960787..2962121)
Genome map
AA seq 444 aa AA seqDB search
MSNNHKISLEDASLNSFHKKLAIYSSGAPFLDGYILSIIGVVMVQLSQALQLSSLQEGMI
AAASLVGMFFGGFVGGLFTDRLGRKTLYVLVLVVLALFSLCQFWVASAWSLIALRLMLGV
AIGADHPLATSLLAEFLPKKQRGSILASLVMMWFVGAAVAYIAGELILRSAGPDAWRWAL
ASAVVPAVLFLVMRAGTPESARWLLSKGRVQEADQVIKKVYGEQYSVRNLPEKTPEQHVS
VWSLFHSNYGKRIFFVSIFWTCSIIPQFAIYAFAPKILSTMGLTGELAAWGAVAITVMFV
FGCLLGVRLINPLGRRNMLMHSFLWSGLALLLLGLCPDGAALLTLMLFGSYALFIGGAQV
LQYVYPNELFPTSIRGSAVGLATSLSRIGAAVGTYLVPLSLDGIGIANTMFVAFGVSMVG
LFVTWLMAPETRSLDLHQASSLSY
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacaatcacaagatttcattggaagatgcatcgctgaacagcttccacaagaag
ctggcgatctattcttccggcgccccattcctcgacggctacatactgagcatcatcggc
gtggtgatggtgcaactgagccaggcgctgcagctgagttcgttgcaggaaggcatgatc
gccgcggcctcgctggtgggcatgttcttcggcggcttcgtcggcggcctgttcaccgac
cggctcgggcgcaagacgctgtacgtgctggtgctggtggtcctggcactgttctccctg
tgccagttctgggtcgcctccgcctggtcgctgatcgccctgcgcctgatgctcggcgtc
gccatcggcgccgaccacccgctggccacttccctgctggccgagttcctgccgaagaaa
cagcgcggctccatcctcgccagcctggtgatgatgtggttcgtcggcgccgccgtggcc
tacatcgccggcgagctgatcctgcgcagcgccggcccggacgcctggcgctgggccctg
gccagcgcggtggtgccggcggtgctgttcctggtcatgcgcgccggcacccccgagtcg
gcccgctggctgctgagcaagggccgcgtgcaggaggccgaccaggtgatcaagaaggtc
tatggcgagcagtactcggtgcgcaacctgccggagaagaccccggagcagcacgtctcg
gtctggtcgctgttccactccaactacggcaagcgcatcttcttcgtcagcatcttctgg
acctgctcgatcatcccgcagttcgccatctacgccttcgccccgaaaatcctcagcacc
atgggcctgaccggcgagctggcggcctggggcgcagtggccatcaccgtgatgttcgtc
ttcggctgcctgctgggcgtccgcctgatcaacccgctgggccggcgcaacatgctcatg
cacagcttcctctggtcgggcctggccctgttgctgctgggcctgtgcccggacggcgcg
gccctgctcacgctgatgttgttcggcagctacgcgctgttcatcggcggcgcccaggtg
ctgcagtacgtgtaccccaacgagctgttccccacctccatccgcggttcggctgtgggc
ctggcgacctcgctgtcgcgcatcggcgcggccgtcggcacctacctggtgcccctgtcg
ctggacggcatcggcatcgccaacaccatgttcgtggccttcggcgtctccatggtgggc
ctcttcgtcacctggctgatggccccggaaacccgttccctggacctgcaccaggccagc
tcgctcagctactga

DBGET integrated database retrieval system