KEGG   Pseudomonas citronellolis: PcP3B5_35780Help
Entry
PcP3B5_35780      CDS       T04637                                 

Gene name
acnA
Definition
(GenBank) Aconitate hydratase 1
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00020  Citrate cycle (TCA cycle)
pcq00630  Glyoxylate and dicarboxylate metabolism
pcq01100  Metabolic pathways
pcq01110  Biosynthesis of secondary metabolites
pcq01120  Microbial metabolism in diverse environments
pcq01130  Biosynthesis of antibiotics
pcq01200  Carbon metabolism
pcq01210  2-Oxocarboxylic acid metabolism
pcq01230  Biosynthesis of amino acids
Module
pcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PcP3B5_35780 (acnA)
   00630 Glyoxylate and dicarboxylate metabolism
    PcP3B5_35780 (acnA)
Enzymes [BR:pcq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     PcP3B5_35780 (acnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AMO76994
UniProt: A0A127MUK0
LinkDB All DBs
Position
4014482..4017214
Genome map
AA seq 910 aa AA seqDB search
MPAVDSLNSLRTLEVGGKTYHYYSLPEAAKQLGDLDKLPKSLKVLLENLLRWEDNHTVNA
DDLRALAGWLKERRSDREIQYRPARVLMQDFTGVPAVVDLAAMRDAMAKAGGDPQKINPL
SPVDLVIDHSVMVDRYASHAAFAENVEIEMQRNGERYAFLRWGQNAFDNFRVVPPGTGIC
HQVNLEYLGRTVWTRDEDGRTYAFPDTLVGTDSHTTMINGLGVLGWGVGGIEAEAAMLGQ
PVSMLIPEVVGFKLTGKLKEGITATDLVLTVTQMLRQKGVVGKFVEFYGDGLADLPLADR
ATIANMAPEYGATCGFFPVDEITLGYLRLSGRPEETVKLVEAYCKAQGLWREKGHEPVFT
DALQLDMGDVEASLAGPKRPQDRVPLGQVGKAFADFLALQPKAARSPEVSRLLNEGGGGA
AVGSTESQGVEYQHEGKSYHLQDGAVVIAAITSCTNTSNPSVMMAAGLLAKKALEKGLQR
KPWVKSSLAPGSKVVTDYFKAAGLTQYLDELGFDLVGYGCTTCIGNSGPLLEPIEKAIQQ
ADLTVASVLSGNRNFEGRVHPLVKTNWLASPPLVVAYALAGSVRLDLTKDALGTGKDGQP
VYLKDIWPSQREIAEAIQKVDTAMFHKEYAEVFQGDEKWRAIEVPQAQTYTWQADSTYIQ
HPPFFEHIADAPPKVADIEKARVLAVLGDSVTTDHISPAGNIKKDSPAGRYLSEHGVAYA
DFNSYGSRRGNHEVMMRGTFANIRIKNEMLGGEEGGNTLHVPSGEKLAIYDAAMRYQAEG
TPLLIIAGKEYGTGSSRDWAAKGTNLLGVKAVIAESFERIHRSNLVGMGVLPLQFTGGQD
RKALNLTGKEVLNIRGLDGELKPHMTLKVEVTREDGKQDSFEVLCRIDTLNEVEYFKAGG
ILHYVLRSLI
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagtggacagcctgaacagccttcgcaccctcgaggtgggcggcaagacctac
cactattacagccttccggaagccgccaagcagctcggcgacctggacaagctgccgaag
tcgctcaaggtgctcttggaaaacctcctgcgctgggaggacaaccatacggtcaacgcc
gacgacctgcgggccctggccggctggctgaaggagcgccgttccgaccgcgagatccag
taccgcccggcgcgggtgctgatgcaggacttcaccggggtgccggcggtggtcgacctg
gccgccatgcgcgacgccatggccaaggccgggggcgatccgcagaagatcaacccgctg
tcgccggtggacctggtcatcgaccactcggtgatggtcgaccgctacgcaagccacgcc
gccttcgccgagaacgtcgagatcgagatgcagcgcaacggcgaacgctacgccttcctg
cgctggggccagaacgccttcgacaacttccgcgtggtgccgccgggcaccggcatctgc
caccaggtcaacctggaatacctgggccgcaccgtgtggaccagggacgaggacgggcgc
acctacgccttccccgacaccctggtcggcaccgactcgcacaccaccatgatcaacggc
ctgggcgtgctcggctggggcgtcggcggcatcgaggccgaggcggcgatgctcggccag
ccggtgtcgatgctgattcccgaggtggtcggcttcaagctcaccggcaagctcaaggag
ggcatcaccgccaccgacctggtgctcaccgtcacccagatgctgcggcagaagggcgtg
gtggggaaattcgtcgagttctacggcgacggcctggccgacctgcccctggccgaccgc
gccaccatcgccaacatggctccggaatacggcgccacctgcggcttcttcccggtggac
gagatcaccctgggctacctgcgcctgtccggccgcccggaagagacggtcaagctggtg
gaggcctactgcaaggcccagggcctgtggcgcgaaaagggccacgagccggtattcacc
gatgccctgcaactggacatgggcgacgtcgaggccagcctggccgggcccaagcgcccg
caggaccgcgtgccgctgggccaggtgggcaaggccttcgccgacttcctcgcgctgcag
cccaaggccgcgcgcagcccggaggtctcgcgcctgctcaatgaaggcggtggcggcgcc
gcggtgggcagcaccgagagccagggcgtcgagtaccagcacgaaggcaagagctaccac
cttcaggacggcgcggtggtcatcgccgccatcacctcctgcaccaacacctccaacccc
agcgtgatgatggccgccgggctgctggcgaagaaggcgctggagaagggcctgcagcgc
aagccctgggtgaagagttcgctggcgcccggctccaaggtggtcaccgactacttcaag
gccgccggcctgacccagtacctggacgagctgggcttcgacctggtgggctacggctgc
accacctgcatcggcaactccgggccactgctggagcccatcgagaaggccatccagcag
gccgacctgacggtggcctcggtgctctccggcaaccgcaacttcgaaggccgcgtgcac
ccgctggtgaagaccaactggctggcctcgccgcccctggtggtggcctacgccctggcc
ggcagcgtgcgcctggacctgacgaaggacgccctgggcaccggcaaggacggccagccg
gtgtacctgaaggacatctggccgagccagcgggaaatcgccgaggcgatccagaaggtc
gacaccgccatgttccacaaggaatacgccgaggtgttccagggcgacgagaagtggcgc
gccatcgaagtgccgcaggcgcagacctacacctggcaggccgactccacctacatccag
cacccgccgttcttcgagcacatcgccgacgccccgccgaaggtggccgacatcgagaag
gcccgggtgctggcggtgctgggcgactcggtgaccaccgaccacatctcccccgccggc
aacatcaagaaggacagccccgccgggcgctacctcagcgagcacggcgtggcctatgcc
gacttcaactcctacggctcgcggcgcggcaaccacgaggtgatgatgcgcggcaccttc
gccaacatccgcatcaagaacgagatgctcggcggcgaggaaggcggcaacaccctgcac
gtgcccagcggcgagaagctggcgatctacgacgcggccatgcgctaccaggccgagggc
acgccgctgctgatcatcgccggcaaggagtacggcaccggttcgtcccgcgactgggca
gccaagggcaccaacctgctgggggtgaaggcggtgatcgccgagagcttcgagcgcatc
caccgctccaacctggtgggcatgggcgtgctgccgctgcagttcaccggcggccaggac
cgcaaggcgctgaacctcaccggcaaggaagtgctgaacatccgcggcctggacggcgag
ctgaagccgcacatgacgctgaaggtggaagtcacccgcgaggacggcaagcaggacagc
ttcgaggtgctgtgccgcatcgacaccctcaacgaggtggagtacttcaaggccgggggg
atcctgcactacgtgctgcgcagcttgatctga

DBGET integrated database retrieval system