KEGG   Pseudomonas citronellolis: PcP3B5_52370Help
Entry
PcP3B5_52370      CDS       T04637                                 

Gene name
sodB_2
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pcq  Pseudomonas citronellolis
Brite
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PcP3B5_52370 (sodB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMO78620
UniProt: A0A127MZI8
LinkDB All DBs
Position
5822306..5822887
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYAKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEDIVKTS
SGGIFNNAAQVWNHTFYWECLTPNGGGQPTGALADAINAAFGSFDKFKEEFTKTAIGTFG
SGWAWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDYVAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgccaagaacgcccttgagccgcacatttcc
gcggaaaccctcgaataccaccacgacaagcaccacaacacctacgtcgtgaacctgaac
aacctgatcccgggcaccgagttcgaaggcaagagcctggaagacatcgtcaagacctct
tcgggcggcatcttcaacaacgcggcccaggtgtggaaccacaccttctactgggaatgc
ctgacccccaacggcggtggccagcccaccggcgccctggccgatgccatcaacgccgcc
ttcggttccttcgacaagttcaaggaagagttcaccaagaccgccatcggcaccttcggc
tccggctgggcctggctggtgaagaaggccgacggctccctggccctggccagcaccatc
ggcgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgacgtgtgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaagccttctggaac
ctggtcaactgggactacgtggcgaagaacttcgctgcctga

DBGET integrated database retrieval system