KEGG   Pseudomonas citronellolis: PcP3B5_61860Help
Entry
PcP3B5_61860      CDS       T04637                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pcq  Pseudomonas citronellolis
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PcP3B5_61860 (ahpF)
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PcP3B5_61860 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO AlaDh_PNT_C FAD_oxidored FAD_binding_3 Glutaredoxin Thi4 K_oxygenase NAD_binding_7 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AMO79538
UniProt: A0A127N248
LinkDB All DBs
Position
complement(6894758..6896323)
Genome map
AA seq 521 aa AA seqDB search
MLDANLKTQLKAYLEKVTQPFEIVASLDDSDKSRELSELLHDIVGLTDKITLREDGGDER
KPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLEPEVIEQVKGIQGKFEF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVEKRQVMSVPSIYLNGEVF
GAGRMGVEEILAKIDTGAAAREAEKLAAKEAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPKLARALEEHVKQYEVDIMNLQRASALVPAKNAGE
LHEVKFEGGGSLKAKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKLYSLPNVDVITSALTSEVKGDG
QKVTGLVYKDRNSEEFKSVELEGIFVQIGLLPNTEWLKGSVELTPRGEIIVDARGETSLP
GIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaagacccagttgaaggcctacctggaaaaggtcacccagccg
ttcgagatagtcgcgtccctcgatgacagcgacaaatcccgcgagctgagcgaactgctg
cacgacatcgtcggcctgaccgacaagatcaccctgcgcgaagacggcggcgacgaacgc
aagccgtccttctcgctgaaccgcccgggggcggacatcggcctgcgtttcgccggtatc
cccatgggccacgagttcacttccctggtgctggccctgctgcaggtcggcggccacccg
tccaagctcgagcccgaagtcatcgagcaggtcaagggcatccagggcaagttcgagttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctcaaccccaacatccgccacgtcgccatcgacggcgcgctgttccaggac
gaggtggagaagcgccaggtcatgtcggtgccgagcatctacctgaacggcgaagtcttc
ggcgcgggccgcatgggcgtggaagaaatcctcgccaagatcgacaccggcgccgccgcc
cgcgaagccgagaagctggccgccaaggaagccttcgacgtgctggtggtgggcggtggc
ccggccggcgcctcggcggccatctacgccgcgcgtaagggcatccgcacgggtgtcgcc
gccgagcgcttcggcggccaggtgctggacaccatggccatcgagaacttcatttcggtg
aaggagaccgaaggcccgaaactggcccgcgcgctggaagagcacgtgaagcagtacgag
gtcgacatcatgaacctgcagcgcgccagcgcgctggtcccggcgaagaatgccggcgag
ttgcacgaagtgaagttcgagggcggcggcagcctcaaggccaagaccgtgatcctcgcc
accggcgcccgctggcgcgagatgggcgtgcccggcgagcaggaatacaaggccaagggc
gtgtgcttctgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtcgaggcggccatcgacctggccggcatcgtcgcccacgtg
accctgctggagttcgacagcaagctgcgcgccgacgccgtgctgcaacgcaagctgtac
agcctgccgaatgtggacgtgatcaccagcgcgctgaccagcgaagtgaagggtgacggc
cagaaagtcaccggcctggtctacaaggaccgcaactcggaagagttcaagtcggtggag
ctggagggcatcttcgtgcagatcggcctgctgccgaacaccgagtggctcaagggcagc
gtcgagctgaccccgcgcggcgagatcatcgtcgatgcgcgcggcgagacttcgctgccg
ggtatcttcgccgccggtgacgtgactacggtgccgtacaagcagatcgtgattgcggtg
ggcgagggggcgaaggcttcgttgtcggccttcgatcacctgatccgtagttctgcgccg
gcctga

DBGET integrated database retrieval system