KEGG   Psychrobacter cryohalolentis: Pcryo_2074Help
Entry
Pcryo_2074        CDS       T00350                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pcr  Psychrobacter cryohalolentis
Brite
KEGG Orthology (KO) [BR:pcr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pcryo_2074
Enzymes [BR:pcr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Pcryo_2074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 DAO Thi4 FAD_binding_2 NAD_binding_8 FAD_oxidored K_oxygenase AlaDh_PNT_C NAD_binding_7 FAD_binding_3 NAD_binding_9 Lycopene_cycl 3HCDH_N Shikimate_DH Glutaredoxin DSBA Thioredoxin_14 ThiF
Motif
Other DBs
NCBI-ProteinID: ABE75851
UniProt: Q1Q902
LinkDB All DBs
Position
complement(2540825..2542402)
Genome map
AA seq 525 aa AA seqDB search
MIDQSLLDAVKSYSVNMTRPISFVLGSGEHSKRAELIDFLSKIAGTTDKINFDAQANDDS
LPSPISFKVISHIDGALTDTGIVFSGIPGGHEFTSLILAILQAGGHTLKLDEGIQKLIKR
FNKPLQFQTYVSLSCHSCPEVVQALNQFALLNDDISNEMIDGALFQEQVEANNIQGVPAV
FLNGKPFANGLIDTAKLIEKLQEQFPDLLAEAEDDAEQLEQQDVTIIGAGPAGVAAAIYT
ARKGLKVTMVADRIGGQVKDTQDIENLISVPLTTGGELSVNFEKHLREYNITLKEHVSVK
EISETADENYRIHLNTGETFETRSIILATGAQWRKLGVAGEEENIGKGVAFCAHCDGPFF
KGKDIAVVGGGNSGIEAALDLAGIVKHVTVLEFADDLKADQVLINKAKEKANIDIITSAA
TQEIKATEGKVSSIIYQDRNSSENKELDVAGVFVQIGLIPNTGFVKGFVDLNRFGEIEID
ERCRTDRKGIFACGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatagaccaaagcttattagatgccgtaaagagctatagcgtaaatatgacccgccca
atcagctttgtcttaggtagtggcgagcatagcaagcgtgctgagttgattgattttttg
agcaaaatcgctggtacgacagataagattaattttgacgcacaagctaacgatgacagt
ttgccaagcccaatcagttttaaagtaatcagtcacattgatggtgctttgacggataca
ggtattgtctttagtggtattcctggtggtcatgaatttacttcattgatattggcgatt
ttgcaagcgggtggtcatacgttaaaactcgatgaaggcattcaaaagctgattaaacgc
tttaataagccactacagtttcaaacttacgtgtcgctttcttgccacagctgcccagaa
gttgtgcaagcgctaaaccaattcgcgctgctaaacgatgacatcagtaatgagatgatc
gatggggcactattccaagagcaagtagaagcgaataatatccaaggcgtaccagcagta
ttcttaaacggcaagccgtttgctaatggtctgattgacacggctaaattgattgagaag
ttacaagagcaatttcctgatttgttagcagaagctgaagatgatgctgaacagttagag
caacaagatgtgacgattattggtgcgggtccagctggggttgctgctgcgatttatacc
gcgcgtaaaggcttaaaagttaccatggtggctgaccgtatcggtgggcaagtaaaagat
acgcaagatattgaaaacttaatctcagtacctttaaccacaggtggcgagctctcggtg
aactttgaaaagcatttgcgcgaatataatattacgcttaaagagcacgtcagcgtcaaa
gagattagtgagacagctgatgaaaattatcgcattcatctgaataccggtgagaccttt
gagacgcgtagtattatcttggcaactggtgctcaatggcgtaagcttggggtcgctggc
gaagaagaaaacatcggtaaaggcgtggctttctgtgcgcactgtgatggtccattcttc
aaaggtaaagatattgccgtcgtcggtggtggtaactctggtatcgaagcggcattagac
cttgctggtatcgtgaagcatgtgaccgtgcttgagtttgctgatgatttgaaagcggat
caggtattgattaataaagccaaagaaaaggcaaatatcgatatcattaccagtgcagcg
acccaagaaattaaagcgactgagggtaaagtatcgtctattatctatcaagatcgcaat
agcagcgagaataaagagcttgatgttgcaggggtgtttgtacagattggcttgatacca
aatactgggttcgttaaaggcttcgtcgatttaaaccgctttggcgagattgaaattgat
gagcgctgccgtacagatcgcaaaggtatctttgcttgtggtgatgttacgactgtaccc
tttaagcagattaatattgcgatgggtgaaggttcaaaagcggcattatcagcgtttgaa
tatttggttatgcagtaa

DBGET integrated database retrieval system