KEGG   Porphyromonas crevioricanis: NCTC12858_00707Help
Entry
NCTC12858_00707   CDS       T05510                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pcre  Porphyromonas crevioricanis
Pathway
pcre00473  D-Alanine metabolism
pcre01100  Metabolic pathways
pcre01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pcre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NCTC12858_00707 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NCTC12858_00707 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pcre01011]
    NCTC12858_00707 (alr)
Enzymes [BR:pcre01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NCTC12858_00707 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:pcre01011]
 Precursor biosynthesis
  Racemase
   NCTC12858_00707 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: SQH72874
UniProt: A0A2X4PG94
LinkDB All DBs
Position
1:778005..780479
Genome map
AA seq 824 aa AA seqDB search
MVSVSEVTDVCKVLESRLQHKGDITILLTDSRSLTNPQGVLFIALVSKHGDGHKYIEELY
GRGVRSFMIEQPLHLWIDLFPEANFFRVENTLKALQLLAIAHRKKFSYPVIGITGSNGKT
VVKEFLNQLLRKDFSIVRSPRSYNSQIGVPLSVWNMGEGHNLGIFEAGISRVGEMARLAR
IIKPTIGVFTCIGTAHQENFKTMEEKLQEKLLLFLDCRVVIYNADNELIRNAIRSSGLEA
RGLGWSMRDRSAPLFVEDVTSTEEMTSITVCFMGLIESFVIPFTDKASIENVIHCIAVLL
YLKPAMLSNADPFLKLEPVAMRLELKEGNHGNIVINDSYNNDYGSLDIALDFQQRRVRTP
GMRRVLILSDILESGMLPKTLYRNVAALIRDRKVDKFFAVGRELAKQRTSFEGIDCSFYE
TTADLLESQELKSISGACILIKGARQFRFEQICDRLSKQVHETTLEINLQSIAQNVEHYS
SLIKPETKMICMVKARGYGVGSYELAKTLEDCHVDYLAVAVADEGKELRERGVRMPIIVM
NPEPTTWSTLLEYKLEPEIYSFSLLRKFMAATMEHGLRSYPIHIKVDSGMHRLGFSPNDM
DELAQLLLLHPEVEVASIFSHLSAADTPEFDQFTLQQIRTFDHAAHALAARLPNKPLMHI
LNTAGIERFSEYQYDMVRLGIGLYGISPNGREGLQGVVRLRSTILQIKEIPAGEPVGYGC
KGVCDHNMRIAVLPIGYADGYRRCLGLGVGQVLVGDKLCPTVGNICMDTCMIDVTEANAF
EGQRVTLFGDPRIPIEEIATRLDTIPYELLSSLSPRVKRLYYRE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggtatctgtctctgaagttacggatgtatgcaaggtcttggaatctcgattgcagcac
aagggggatattacgatcctgcttaccgatagtcgttctctgactaatccgcagggagtt
ctgttcatagctcttgtctccaagcatggagatgggcataaatatatagaggagttgtat
ggccgtggtgtgcgtagctttatgatagagcaacctctccatttgtggatagatttattt
ccggaggccaatttctttcgggtggagaatacgctcaaggctctgcaactattggctatt
gctcatcgcaagaagttttcctatccagtgatagggatcacgggtagcaatggtaagaca
gttgtaaaggagtttttgaaccagctgcttcgcaaagatttctctattgtccgttcccca
cgtagttataactctcagatcggggtccccttgagtgtctggaatatgggagaggggcat
aacctggggatattcgaagccggtatttctcgagttggtgagatggcccgattggccagg
attatcaagccgactatcggtgtctttacttgtatcggcacggctcatcaagagaatttc
aaaaccatggaagagaagttgcaggagaagttgctgctctttctggattgtagggttgtg
atttataatgccgataatgaacttattcgcaatgcaattcgatcctctggtctggaggct
cgtggcctgggttggagcatgagggatcgttcggccccgctttttgtggaagatgtgact
tcgactgaagaaatgacttccattacagtatgtttcatgggtttgatagagagctttgtg
attccttttaccgacaaggcctctatcgagaatgtgattcactgtattgctgtgctgctt
tacctcaaaccagccatgctgagcaatgccgatcctttcctcaaactggagccggtggct
atgcgtcttgaattgaaagaggggaaccatggaaatatcgtaatcaatgattcgtacaac
aacgattatggttccctcgatatagctttggactttcagcagcgcagggttcgtacgcca
gggatgagacgggtactgatcttgagtgatatattggagagcggaatgttgcccaaaacg
ctctatcgcaatgtagccgccttgatacgcgaccgcaaggtggataagttttttgctgtg
ggaagagagctggccaaacaaagaacgtctttcgaagggatcgattgttctttctacgaa
acaacagccgatttgcttgaatctcaagaacttaaatccatttctggagcctgtatcttg
atcaaaggggcaaggcagttccgctttgagcagatttgcgacagattgtctaagcaggta
catgagacaactttggagatcaacctgcaatctattgcacagaatgtggagcattacagc
tctcttatcaagcccgagaccaaaatgatttgtatggtcaaggcacgtggctatggtgtg
ggatcctatgagcttgccaaaacattggaagactgccatgttgattatttggctgttgct
gtggcagatgaaggaaaagaattgagggagagaggagtgcgtatgcctatcattgtgatg
aaccccgagccgacaacatggagtactttgctggaatacaaacttgagccggagatctat
agcttttccttgctgcggaagtttatggcggcaactatggagcacggactccggtcttat
cctattcacatcaaggtagacagcgggatgcatcgtttgggcttttctcccaatgatatg
gatgagcttgcgcagttgcttttgctccatcctgaggtggaggttgccagtatcttttct
catttatcagcagcagatacaccggagttcgaccagtttactctgcaacagatacgaacc
tttgatcatgcagctcatgcactcgctgcccggttgcccaataagcctttgatgcatatc
ctcaatacggctgggatagaacgtttctctgagtatcagtatgatatggtgcgccttggt
atcggattgtatgggatcagtcctaacggcagagagggactgcagggtgtggtgcgtctg
cgctctactattttgcaaatcaaagaaatacctgcaggagagcccgtaggctatggctgt
aagggggtgtgcgatcataatatgcgtatcgctgtgcttccgattggttatgctgatggg
tataggcgttgccttggtttgggagttggacaagtattggtcggagacaaactctgtcct
accgtgggaaatatttgcatggatacctgtatgatagatgtcactgaggctaatgctttt
gaggggcagcgtgttactcttttcggtgatcctcgtatccctattgaagagatagcaacc
cggctcgatacaatcccatatgagctactctcctctctctctcctagagtgaaacgcctt
tattaccgcgaatag

DBGET integrated database retrieval system