KEGG   Porphyromonas crevioricanis: NCTC12858_01678Help
Entry
NCTC12858_01678   CDS       T05510                                 

Gene name
yihY
Definition
(GenBank) YihY family inner membrane protein
  KO
K07058  membrane protein
Organism
pcre  Porphyromonas crevioricanis
Brite
KEGG Orthology (KO) [BR:pcre00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    NCTC12858_01678 (yihY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB HTH_24 TrmB MarR_2
Motif
Other DBs
NCBI-ProteinID: SQH73807
UniProt: A0A0A2FHK6
LinkDB All DBs
Position
1:complement(1917721..1919145)
Genome map
AA seq 474 aa AA seqDB search
MSKKSNKRSEGLSRENLPKKHSKLHYVWVWILVSIRFITRDMWRLRDDELRGMRGVLARI
LRPVCVSAKAFIDDGLFSKASALTYDTILSIVPMLAVLIGIAKGFGIQQLLSNFLYTYLP
SHHQELNKIMGFVDNYFSQIQGGVFVGIGLVILLYTVISLIVSIEDTFNRIWQCSSSRPW
GRRIVDYLAIFIIIPILITFSSGLTLVMSTVRSALPMQYGLIAPALEFFLNLTPFFIIIF
IFTASYMALPNTKVKFFPALISAVLAGIAFQVLQALYINGVIWISKYNAIYGSFAAIPLM
FMFIQVSWAICLFGAQLAFSIQNVRNFAFEQDARSISRRYLDFLTILVASRIVQRFDNVQ
NNEPYTAEEISAECKIPIKLTSNIIRRLLKMGIIIEVFYKQEREVGHYHPALAPDILTVG
YLMQRIDSFGSERFRVDNEGVYRELWQAVLASRAGFTSIENQTLLRDLRYVSGS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagaagtcgaataaacgatccgaaggattgtctcgggaaaatctccccaaaaaa
cattccaagctgcattatgtctgggtatggatattggtaagcattcgtttcattactcgc
gatatgtggcgtttgcgggatgatgaattgaggggaatgagaggggtattggcacgtatt
ctgcgcccggtatgtgtatctgccaaggcttttatagatgacggccttttctctaaagct
tctgctttgacctacgatacaatcctttctattgtacccatgttggctgtgcttatcggg
atagccaagggttttgggatacagcaactcttatcgaattttctatacacctatctgcct
tctcaccaccaagagctgaataagatcatggggtttgtcgataactatttctctcaaatt
cagggaggagtatttgttggtattggtctggtgattttgctctatacggtgatctctcta
attgtgtctatcgaggatactttcaatcgaatttggcaatgtagttcgtccagaccgtgg
ggacgtcggattgtggattatctcgccatttttatcatcatccctatcctgattactttt
tcttccggtcttaccctggtgatgtctaccgttcgatcagcattgcccatgcagtacggt
ttgattgctccggccttggagttttttctcaacctgacccctttctttatcatcatattc
attttcacagcctcttatatggctttgccgaatacgaaggtcaagttttttcctgcgctt
atatcggcagttttggccggaatagcatttcaggtgctgcaggctttgtatatcaatggg
gttatatggatttctaaatacaacgctatctatggtagttttgctgctatccccttgatg
ttcatgtttatccaagtttcttgggcaatttgtctttttggggcgcagttggctttttcg
atacagaatgtacgaaactttgcctttgagcaagacgctcgctcgatttcccggcgttac
ttggattttctgactatactggttgcttcgcgcatcgttcaacgtttcgacaatgtccag
aacaatgagccttatacagccgaagaaatttcggcagagtgcaaaatcccaatcaaattg
acctcaaatattattcgcagactgctcaaaatgggcattatcatagaggttttctacaaa
caagagcgagaggtcggacattaccatcctgccttggctcccgatattctcactgttggc
tatttgatgcagcgtatagatagcttcggcagtgagcgtttcagagtagataatgagggt
gtctaccgtgagctttggcaggctgttttggcttccagagcaggttttacttcgattgaa
aatcagaccttactcagagaccttcgctatgtcagcggatcttaa

DBGET integrated database retrieval system